ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 is the Eureka Cluster on software innovation
Download PDF version ITEA Challenge

Smart cities

Introduction

There is an inevitability that we must face – urbanisation is an unstoppable demographic trend and cities will not get any smaller. With the number of megacities and the people living in them increasing exponentially, the question that arises is how can these cities be smarter with what they have at their disposal? Software platforms along with the massive deployment of wireless ICT will become key to supporting the management of cities, whether in terms of housing, energy, mobility or emergency services. ICT is an opportunity to solve many of the cities' problems: transportation, e-Government, Machineto- Machine communication. How can the traffic intensity be managed, for example? What smart solutions can make the streets safer at night? And how can smart villages counteract the digital divide and prevent rural life becoming more difficult?


Some facts and figures

  • The United Nations estimates that by 2030 nearly 60% of the world's population will be living in an urban environment; in 1900, this number was only 13%. This rise in urbanisation affects not only industrialised nations (80% by 2030) but particularly developing countries (55% by 2030). All over the world, this creates political, scientific and economic challenges. There is a need for smart cities among the whole global community. [1]
  • If reports are correct, cities would have to spend a staggering USD 350 trillion or almost 5 times current global GDP in the next 30 years on urban infrastructure. [2] But since this is not really feasible we need to find smart ways to address these urgent needs.
  • Deploying smart technologies in key areas of electricity grids, transport, logistics, buildings and industrial motors could cut global emissions by 15% in 2020, and around USD 900 billion a year in energy savings for global industry by 2020. [2]
  • As in many cities, the Dutch capital of The Hague wants to encourage citizens to engage with each other to influence how their city develops smart urban solutions. Democracy 3.0 is a tool to give citizens power over the allocation of 2-3% of local taxes by allowing their proposals to be voted on. [3]
  • Big data and smart technologies can help engage citizens and business in the process of improving a city and its services. E.g.
    • in Boston, citizens use a digital application to register concerns about streets that need cleaning or potholes that need fixing, helping the city authorities to address the problems quickly without first having to dispatch employees to investigate. Potholes, for example, are detected by volunteer citizens who use a mobile app that applies an accelerometer and GPS to record and locate any bumps hit by the car the user is driving. [4]
    • Bucheon City in South Korea provides drivers with real-time traffic information from various sources, such as cameras and speed radars, helping drivers to avoid congested roads and city authorities to track traffic volumes and plan for new roads. [4]

Imagine …

Imagine arriving at one of the airports that serve the megacity of the future. It's a daunting prospect if you don't know your way around. How can you get to your destination quickly and cheaply? And when you arrive, what kind of interesting cultural events might attract your interest or where is the best place to dine? We're not all the same. So how can you personalise your trip? How can you get the best out of the opportunity? And who can do what? Who takes the lead in developing solutions? Who innovates what? Communicates the possibilities?

Imagine what is possible when we dare to dream, when we reach for the stars in a galaxy full of opportunities …


References

[1] Smart cities – German High Technology for the cities of the future, tasks and opportunities. acatech – National Academy of Science and Engineering, May 2011.

[2] Information Marketplaces – The New Economics of Cities. A report by: The Climate Group, Arup, Accenture and Horizon, University of Nottingham, 2011.

[3] Innovation in Europe's cities. A report by LSE Cities on Bloomberg Philanthropies' 2014 Mayors Challenge, February 2015.

[4] How to make a city great. McKinsey&Company, September 2013.

Projects related to the challenge Smart cities

AI Call 2020

AI4PV

Artificial Intelligence for Operation and Maintenance of PV Plants

AI Call 2020
Winner ITEA Award Of Excellence Standardisation 2022
project header

AIDEMS

AI-Enabled Demand Side Management for Energy Sustainability

ITEA 3 Call 4

CityStory

Citizen Storytelling

ITEA 3 Call 4

POLDER

Urban Data Policy Lab: POLicy & Data Exploitation & Re-use

ITEA 3 Call 3

BIMy

BIM in the City

ITEA 3 Call 3

ProSe

Proximity Services Framework

ITEA 3 Call 2

CitiSim

Smart City 3D simulation and monitoring platform

ITEA 3 Call 2

MOS2S

Media Orchestration - Sensor to Screen

ITEA 3 Call 2

PS-CRIMSON

Public Safety and Crisis Management Service Orchestration

ITEA 2 Call 8

C³PO

Collaborative City Co-design PlatfOrm

ITEA 2 Call 8

FUSE-IT

Future Unified System for Energy and Information Technology

ITEA 2 Call 8

M2MGrids

Smart M2M Grids – M2M Internet for dynamic M2M Information Business ecosystem

ITEA 2 Call 8

WATER-M

Unified Intelligent WATER Management

ITEA 2 Call 7

SEAS

Smart Energy Aware Systems

ITEA 2 Call 5

ENERFICIENCY

User Led Energy Efficiency Management

ITEA 2 Call 4
Winner ITEA Excellence Award 2021
project header

IMPONET

Intelligent Monitoring of Power Networks

ITEA 2 Call 3

NEMO_CODED

Networked Monitoring & Control, Diagnostic for Electrical Distribution

ITEA 2 Call 3
Winner ITEA Excellence Award 2021
project header

SUS

SUS

Smart Urban Spaces


Laminas
Documentation Modules Gallery PHP Version 8.0.14 Extensions intl ModulesLaminas\CacheLaminas\RouterLaminas\FormLaminas\NavigationLaminas\FilterLaminas\HydratorLaminas\InputFilterLaminas\PaginatorLaminas\LogLaminas\ValidatorLaminas\Mvc\Plugin\FlashMessengerLaminas\Mvc\Plugin\IdentityLaminas\ApiToolsLaminas\ApiTools\DocumentationLaminas\ApiTools\Documentation\SwaggerLaminas\ApiTools\ApiProblemLaminas\ApiTools\ConfigurationLaminas\ApiTools\OAuth2Laminas\ApiTools\MvcAuthLaminas\ApiTools\HalLaminas\ApiTools\ContentNegotiationLaminas\ApiTools\ContentValidationLaminas\ApiTools\RestLaminas\ApiTools\RpcLaminas\ApiTools\VersioningApiLmcCorsAssetManagerZfcTwigBjyAuthorizeJield\AuthorizeDoctrineModuleDoctrineORMModuleApplicationContentGeneralClusterNewsContactQualityProjectEvaluationPressProgramSearchAdminLaminasBootstrap5AffiliationOrganisationPublicationInvoiceDeeplinkEventCalendarMailingLaminasGoogleAnalyticsAccountingErrorHeroModuleCirclicalRecaptchaSlmQueueSlmQueueDoctrineLaminas\DeveloperTools
Request and Response 200 NodeController::node on content-route-11
Status code 200 Method GET Controller Content\Controller\NodeController Action node Other Route Parameters
^ array:1 [
  "docRef" => "smart-cities"
]
Route content-route-11 Template layout/layout

  content: string

Template content/node/node

  node: Content\Entity\Node

Execution Time 423.02 ms
1. route 88.83 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
2. authentication 91.80 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
3. authentication.post 91.99 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
4. authorization 92.10 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
5. authorization.post 92.22 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
6. dispatch 105.30 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
7. dispatch 105.65 ms
File: src/DispatchListener.php - Line: 132
Target: Content\Controller\NodeController
8. render 118.49 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
9. renderer 131.95 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
10. renderer.post 132.03 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
11. renderer 132.08 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
12. renderer.post 132.13 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
13. isAllowed 405.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
14. isAllowed 405.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
15. isAllowed 405.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
16. isAllowed 405.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
17. isAllowed 405.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
18. isAllowed 405.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
19. isAllowed 405.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
20. isAllowed 405.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
21. isAllowed 405.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
22. isAllowed 405.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
23. isAllowed 405.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
24. isAllowed 406.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
25. isAllowed 406.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
26. isAllowed 406.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
27. isAllowed 406.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
28. isAllowed 406.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
29. isAllowed 406.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
30. isAllowed 406.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
31. isAllowed 406.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
32. isAllowed 406.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
33. isAllowed 406.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
34. isAllowed 406.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
35. isAllowed 406.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
36. isAllowed 406.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
37. isAllowed 406.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
38. isAllowed 406.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
39. isAllowed 406.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
40. isAllowed 407.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
41. isAllowed 407.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
42. isAllowed 407.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
43. isAllowed 407.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
44. isAllowed 407.23 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
45. isAllowed 407.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
46. isAllowed 407.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
47. isAllowed 407.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
48. isAllowed 407.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
49. isAllowed 407.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
50. isAllowed 407.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
51. isAllowed 407.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
52. isAllowed 407.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
53. isAllowed 407.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
54. isAllowed 407.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
55. isAllowed 407.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
56. isAllowed 407.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
57. isAllowed 408.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
58. isAllowed 408.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
59. isAllowed 408.14 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
60. isAllowed 408.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
61. isAllowed 408.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
62. isAllowed 408.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
63. isAllowed 408.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
64. isAllowed 408.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
65. isAllowed 408.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
66. isAllowed 408.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
67. isAllowed 408.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
68. isAllowed 408.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
69. isAllowed 408.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
70. isAllowed 408.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
71. isAllowed 408.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
72. isAllowed 408.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
73. isAllowed 408.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
74. isAllowed 408.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
75. isAllowed 409.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
76. isAllowed 409.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
77. isAllowed 409.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
78. isAllowed 409.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
79. isAllowed 409.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
80. isAllowed 410.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
81. isAllowed 410.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
82. isAllowed 410.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
83. isAllowed 410.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
84. isAllowed 410.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
85. isAllowed 410.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
86. isAllowed 410.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
87. isAllowed 410.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
88. isAllowed 410.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
89. isAllowed 410.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
90. isAllowed 411.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
91. isAllowed 411.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
92. isAllowed 411.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
93. isAllowed 411.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
94. isAllowed 411.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
95. isAllowed 411.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
96. isAllowed 411.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
97. isAllowed 412.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
98. isAllowed 412.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
99. isAllowed 412.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
100. isAllowed 412.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
101. isAllowed 412.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
102. isAllowed 412.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
103. isAllowed 412.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
104. isAllowed 412.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
105. isAllowed 412.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
106. isAllowed 413.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
107. isAllowed 413.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
108. isAllowed 413.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
109. isAllowed 413.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
110. isAllowed 413.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
111. isAllowed 413.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
112. isAllowed 413.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
113. isAllowed 413.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
114. isAllowed 413.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
115. isAllowed 414.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
116. isAllowed 414.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
117. isAllowed 414.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
118. isAllowed 414.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
119. isAllowed 414.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
120. isAllowed 414.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
121. isAllowed 414.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
122. isAllowed 414.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
123. isAllowed 415.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
124. isAllowed 415.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
125. isAllowed 415.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
126. isAllowed 415.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
127. isAllowed 415.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
128. isAllowed 415.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
129. isAllowed 415.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
130. isAllowed 416.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
131. isAllowed 416.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
132. isAllowed 416.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
133. isAllowed 416.31 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
134. isAllowed 416.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
135. isAllowed 416.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
136. isAllowed 416.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
137. isAllowed 416.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
138. isAllowed 417.32 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
139. isAllowed 417.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
140. isAllowed 417.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
141. isAllowed 417.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
142. isAllowed 417.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
143. isAllowed 417.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
144. isAllowed 417.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
145. isAllowed 417.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
146. isAllowed 417.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
147. isAllowed 417.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
148. isAllowed 417.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
149. isAllowed 417.96 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
150. isAllowed 418.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
151. isAllowed 418.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
152. isAllowed 418.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
153. isAllowed 418.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
154. isAllowed 418.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
155. isAllowed 418.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
156. isAllowed 418.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
157. isAllowed 418.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
158. isAllowed 418.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
159. isAllowed 418.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
160. isAllowed 418.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
161. isAllowed 418.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
162. isAllowed 418.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
163. isAllowed 418.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
164. isAllowed 418.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
165. isAllowed 418.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
166. isAllowed 418.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
167. isAllowed 419.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
168. isAllowed 419.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
169. isAllowed 419.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
170. isAllowed 419.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
171. isAllowed 419.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
172. isAllowed 419.43 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
173. isAllowed 419.48 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
174. isAllowed 419.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
175. isAllowed 419.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
176. isAllowed 419.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
177. isAllowed 419.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
178. isAllowed 419.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
179. isAllowed 419.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
180. isAllowed 419.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
181. isAllowed 419.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
182. isAllowed 420.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
183. isAllowed 420.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
184. isAllowed 420.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
185. isAllowed 420.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
186. isAllowed 420.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
187. isAllowed 420.31 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
188. isAllowed 420.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
189. isAllowed 420.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
190. isAllowed 420.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
191. isAllowed 420.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
192. isAllowed 420.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
193. isAllowed 420.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
194. isAllowed 420.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
195. isAllowed 420.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
196. isAllowed 420.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
197. response 422.19 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
198. finish 422.29 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
199. collected 868.96 ms
File: Listener/ProfilerListener.php - Line: 86
Target: NULL
Total Time 423.02 ms
Memory Peak 2.00 MB
1. route 2.00 MB

public/index.php - Line: 31

2. authentication 2.00 MB

src/EventManager.php - Line: 319

3. authentication.post 2.00 MB

src/EventManager.php - Line: 319

4. authorization 2.00 MB

src/EventManager.php - Line: 319

5. authorization.post 2.00 MB

src/EventManager.php - Line: 319

6. dispatch 2.00 MB

public/index.php - Line: 31

7. dispatch 2.00 MB

src/DispatchListener.php - Line: 132

8. render 2.00 MB

src/Application.php - Line: 341

9. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

10. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

11. renderer 2.00 MB

src/View.php - Line: 222

12. renderer.post 2.00 MB

src/View.php - Line: 222

13. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

14. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

15. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

16. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

17. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

18. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

19. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

20. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

21. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

22. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

23. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

24. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

25. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

26. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

27. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

28. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

29. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

30. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

31. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

32. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

33. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

34. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

35. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

36. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

37. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

38. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

39. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

40. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

41. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

42. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

43. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

44. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

45. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

46. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

47. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

48. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

49. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

50. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

51. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

52. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

53. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

54. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

55. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

56. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

57. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

58. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

59. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

60. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

61. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

62. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

63. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

64. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

65. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

66. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

67. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

68. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

69. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

70. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

71. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

72. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

73. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

74. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

75. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

76. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

77. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

78. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

79. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

80. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

81. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

82. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

83. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

84. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

85. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

86. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

87. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

88. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

89. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

90. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

91. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

92. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

93. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

94. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

95. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

96. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

97. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

98. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

99. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

100. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

101. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

102. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

103. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

104. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

105. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

106. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

107. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

108. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

109. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

110. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

111. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

112. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

113. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

114. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

115. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

116. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

117. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

118. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

119. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

120. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

121. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

122. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

123. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

124. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

125. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

126. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

127. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

128. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

129. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

130. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

131. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

132. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

133. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

134. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

135. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

136. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

137. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

138. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

139. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

140. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

141. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

142. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

143. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

144. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

145. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

146. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

147. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

148. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

149. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

150. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

151. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

152. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

153. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

154. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

155. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

156. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

157. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

158. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

159. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

160. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

161. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

162. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

163. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

164. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

165. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

166. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

167. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

168. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

169. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

170. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

171. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

172. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

173. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

174. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

175. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

176. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

177. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

178. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

179. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

180. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

181. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

182. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

183. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

184. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

185. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

186. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

187. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

188. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

189. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

190. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

191. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

192. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

193. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

194. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

195. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

196. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

197. response 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

198. finish 2.00 MB

src/Application.php - Line: 341

199. collected 2.00 MB

Listener/ProfilerListener.php - Line: 86

Memory Peak 2.00 MB
Config Config
Merged Config (Config)
^ array:66 [
  "service_manager" => array:7 [
    "abstract_factories" => array:11 [
      0 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      1 => "Laminas\Form\FormAbstractServiceFactory"
      2 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      3 => "Laminas\Log\LoggerAbstractServiceFactory"
      4 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      6 => "Laminas\ApiTools\DbConnectedResourceAbstractFactory"
      7 => "Laminas\ApiTools\TableGatewayAbstractFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      8 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      9 => "Laminas\Log\LoggerAbstractServiceFactory"
    ]
    "factories" => array:731 [
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\Navigation\Navigation" => "Laminas\Navigation\Service\DefaultNavigationFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "Laminas\ApiTools\MvcAuth\UnauthenticatedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\UnauthorizedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\Factory\ApiFactoryFactory"
      "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategyFactory"
      "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Factory\RenderErrorListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Factory\SendApiProblemResponseListenerFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemRendererFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemStrategyFactory"
      "Laminas\ApiTools\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\Factory\ConfigResourceFactory"
      "Laminas\ApiTools\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\Factory\ResourceFactoryFactory"
      "Laminas\ApiTools\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\Factory\ConfigWriterFactory"
      "Laminas\ApiTools\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\Factory\ModuleUtilsFactory"
      "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter" => "Application\Authentication\Factory\PdoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Factory\MongoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationServiceFactory"
      "Laminas\ApiTools\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\MvcAuth\Factory\NamedOAuth2ServerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication" => "Laminas\ApiTools\MvcAuth\Factory\AuthenticationServiceFactory"
      "Laminas\ApiTools\MvcAuth\ApacheResolver" => "Laminas\ApiTools\MvcAuth\Factory\ApacheResolverFactory"
      "Laminas\ApiTools\MvcAuth\FileResolver" => "Laminas\ApiTools\MvcAuth\Factory\FileResolverFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthenticationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\AuthHttpAdapter" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthHttpAdapterFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization" => "Laminas\ApiTools\MvcAuth\Factory\AclAuthorizationFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthorizationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultResourceResolverListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultResourceResolverListenerFactory"
      "Laminas\Authentication\Storage\NonPersistent" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Factory\LinkExtractorFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Factory\LinkCollectionExtractorFactory"
      "Laminas\ApiTools\Hal\HalConfig" => "Laminas\ApiTools\Hal\Factory\HalConfigFactory"
      "Laminas\ApiTools\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\Factory\HalJsonRendererFactory"
      "Laminas\ApiTools\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\Factory\HalJsonStrategyFactory"
      "Laminas\ApiTools\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Factory\LinkUrlBuilderFactory"
      "Laminas\ApiTools\Hal\MetadataMap" => "Laminas\ApiTools\Hal\Factory\MetadataMapFactory"
      "Laminas\ApiTools\Hal\RendererOptions" => "Laminas\ApiTools\Hal\Factory\RendererOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentTypeFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentNegotiationOptions" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentNegotiationOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\HttpMethodOverrideListener" => "Laminas\ApiTools\ContentNegotiation\Factory\HttpMethodOverrideListenerFactory"
      "Laminas\ApiTools\ContentValidation\ContentValidationListener" => "Laminas\ApiTools\ContentValidation\ContentValidationListenerFactory"
      "Laminas\ApiTools\Rest\OptionsListener" => "Laminas\ApiTools\Rest\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Rpc\OptionsListener" => "Laminas\ApiTools\Rpc\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\Factory\ContentTypeListenerFactory"
      "Laminas\ApiTools\Versioning\VersionListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Api\V1\Rest\ContactResource\MeListener" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "LmcCors\Mvc\CorsRequestListener" => "LmcCors\Factory\CorsRequestListenerFactory"
      "LmcCors\Options\CorsOptions" => "LmcCors\Factory\CorsOptionsFactory"
      "LmcCors\Service\CorsService" => "LmcCors\Factory\CorsServiceFactory"
      "AssetManager\Service\AssetManager" => "AssetManager\Service\AssetManagerServiceFactory"
      "AssetManager\Service\AssetFilterManager" => "AssetManager\Service\AssetFilterManagerServiceFactory"
      "AssetManager\Service\AssetCacheManager" => "AssetManager\Service\AssetCacheManagerServiceFactory"
      "AssetManager\Resolver\AggregateResolver" => "AssetManager\Service\AggregateResolverServiceFactory"
      "AssetManager\Resolver\MapResolver" => "AssetManager\Service\MapResolverServiceFactory"
      "AssetManager\Resolver\PathStackResolver" => "AssetManager\Service\PathStackResolverServiceFactory"
      "AssetManager\Resolver\PrioritizedPathsResolver" => "AssetManager\Service\PrioritizedPathsResolverServiceFactory"
      "AssetManager\Resolver\CollectionResolver" => "AssetManager\Service\CollectionResolverServiceFactory"
      "AssetManager\Resolver\ConcatResolver" => "AssetManager\Service\ConcatResolverServiceFactory"
      "AssetManager\Resolver\AliasPathStackResolver" => "AssetManager\Service\AliasPathStackResolverServiceFactory"
      "Twig\Environment" => "ZfcTwig\Twig\EnvironmentFactory"
      "Twig\Loader\ChainLoader" => "ZfcTwig\Twig\ChainLoaderFactory"
      "ZfcTwig\Twig\Extension" => "ZfcTwig\Twig\ExtensionFactory"
      "ZfcTwig\Twig\MapLoader" => "ZfcTwig\Twig\MapLoaderFactory"
      "ZfcTwig\Twig\StackLoader" => "ZfcTwig\Twig\StackLoaderFactory"
      "ZfcTwig\View\TwigRenderer" => "ZfcTwig\View\TwigRendererFactory"
      "ZfcTwig\View\TwigResolver" => "ZfcTwig\View\TwigResolverFactory"
      "ZfcTwig\View\HelperPluginManager" => "ZfcTwig\View\HelperPluginManagerFactory"
      "ZfcTwig\View\TwigStrategy" => "ZfcTwig\View\TwigStrategyFactory"
      "ZfcTwig\ModuleOptions" => "ZfcTwig\ModuleOptionsFactory"
      "BjyAuthorize\Cache" => "BjyAuthorize\Service\CacheFactory"
      "BjyAuthorize\CacheKeyGenerator" => "BjyAuthorize\Service\CacheKeyGeneratorFactory"
      "BjyAuthorize\Config" => "Jield\Authorize\Factory\ConfigServiceFactory"
      "BjyAuthorize\Guards" => "BjyAuthorize\Service\GuardsServiceFactory"
      "BjyAuthorize\RoleProviders" => "BjyAuthorize\Service\RoleProvidersServiceFactory"
      "BjyAuthorize\ResourceProviders" => "BjyAuthorize\Service\ResourceProvidersServiceFactory"
      "BjyAuthorize\RuleProviders" => "BjyAuthorize\Service\RuleProvidersServiceFactory"
      "BjyAuthorize\Service\RoleDbTableGateway" => "BjyAuthorize\Service\UserRoleServiceFactory"
      "BjyAuthorize\Collector\RoleCollector" => "BjyAuthorize\Service\RoleCollectorServiceFactory"
      "BjyAuthorize\Guard\Controller" => "BjyAuthorize\Service\ControllerGuardServiceFactory"
      "BjyAuthorize\Guard\Route" => "BjyAuthorize\Service\RouteGuardServiceFactory"
      "BjyAuthorize\Provider\Identity\AuthenticationIdentityProvider" => "BjyAuthorize\Service\AuthenticationIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\LmcUserLaminasDb" => "BjyAuthorize\Service\LmcUserLaminasDbIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\ProviderInterface" => "BjyAuthorize\Service\IdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Resource\Config" => "BjyAuthorize\Service\ConfigResourceProviderServiceFactory"
      "BjyAuthorize\Provider\Role\Config" => "BjyAuthorize\Service\ConfigRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\LaminasDb" => "BjyAuthorize\Service\LaminasDbRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\ObjectRepositoryProvider" => "BjyAuthorize\Service\ObjectRepositoryRoleProviderFactory"
      "BjyAuthorize\Provider\Rule\Config" => "BjyAuthorize\Service\ConfigRuleProviderServiceFactory"
      "BjyAuthorize\Service\Authorize" => "BjyAuthorize\Service\AuthorizeFactory"
      "BjyAuthorize\View\UnauthorizedStrategy" => "BjyAuthorize\Service\UnauthorizedStrategyServiceFactory"
      "Jield\Authorize\View\UnauthorizedStrategy" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Jield\Authorize\Service\AuthorizeService" => "Jield\Authorize\Factory\AuthorizeServiceFactory"
      "Jield\Authorize\Service\AssertionService" => "Jield\Authorize\Factory\AssertionServiceFactory"
      "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider" => "Jield\Authorize\Factory\AuthenticationIdentityProviderFactory"
      "Jield\Authorize\Rule\RulesWithAssertion" => "Jield\Authorize\Factory\RuleWithAssertionFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "doctrine.cache.application_cache" => "Application\Factory\StorageCacheFactory"
      "Laminas\Cache\Storage\Adapter\Redis" => "Application\Factory\LaminasCacheFactory"
      "Application\Event\InjectAclInNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\SetTitle" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Application\Event\BlockInactiveContact" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\RegisterPageview" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\I18n\Translator\TranslatorInterface" => "Application\Factory\TranslatorServiceFactory"
      "Application\Service\FormService" => "Application\Factory\FormServiceFactory"
      "Application\Options\ModuleOptions" => "Application\Factory\ModuleOptionsFactory"
      "Application\Authentication\Storage\AuthenticationStorage" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Authentication\AuthenticationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Session\SaveHandler\DoctrineGateway" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Twig\DatabaseTwigLoader" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "cms_navigation" => "Content\Navigation\Factory\ContentNavigationFactory"
      "Content\Service\ContentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\NodeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\VimeoService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\ArticleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\RouteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Event\InitRoutes" => "Application\Factory\InvokableFactory"
      "Content\InputFilter\HandlerFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\RouteFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\SegmentFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TopicFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Options\ModuleOptions" => "Content\Factory\ModuleOptionsFactory"
      "Content\Navigation\Service\ContentNavigationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ContentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\HandlerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\NodeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ParamLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\RouteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\SegmentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Content\Acl\Assertion\Node" => "Application\Factory\InvokableFactory"
      "General\Options\ModuleOptions" => "General\Factory\ModuleOptionsFactory"
      "General\Options\EmailOptions" => "General\Factory\EmailOptionsFactory"
      "General\InputFilter\ChallengeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\Challenge\TypeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\CountryFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\GenderFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\LanguageFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\ExchangeRateFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\TitleFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\WebInfoFilter" => "Application\Factory\InputFilterFactory"
      "General\Service\GeneralService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\CountryService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\EmailService" => "Application\Factory\InvokableFactory"
      "General\Search\Service\CountrySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Mail\Transport\Smtp" => "General\Factory\SmtpTransportFactory"
      "Laminas\Mail\Transport\Sendmail" => "General\Factory\SendmailTransportFactory"
      "Mailjet\Client" => "General\Factory\MailjetClientFactory"
      "General\Navigation\Invokable\ChallengeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ChallengeTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ContentTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\EmailMessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\Country\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LanguageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CurrencyLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\PasswordLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\GenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\TitleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\WebInfoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Cluster\Command\UpdateProject" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Command\GenerateProjectJson" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Options\ModuleOptions" => "Cluster\Factory\ModuleOptionsFactory"
      "Cluster\Acl\Assertion\ClusterAssertion" => "Application\Factory\InvokableFactory"
      "Cluster\Form\ClusterForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\InputFilter\ClusterFilter" => "Application\Factory\InputFilterFactory"
      "Cluster\Service\ClusterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Navigation\Invokable\ClusterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Service\NewsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\BlogService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\MagazineService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\InputFilter\Blog\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\Blog\TagFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\News\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\MagazineFilter" => "Application\Factory\InputFilterFactory"
      "News\Acl\Assertion\Magazine" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Magazine\Article" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Blog" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\News" => "Application\Factory\InvokableFactory"
      "News\Search\Service\NewsSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Search\Service\BlogSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Navigation\Invokable\BlogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\TagLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\NewsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\News\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\MagazineLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Magazine\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Command\ResetAccess" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Provider\ContactProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Contact\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\FacebookLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\OptInLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\AddressLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\DndLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\NoteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\PhoneLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Selection\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\LeaveLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\SelectionContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\AddressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\Office\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\ContactForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\InputFilter\AddressFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\PhoneFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\FacebookFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\DndFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\OptInFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Selection\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\LeaveFilter" => "Application\Factory\InputFilterFactory"
      "Contact\Search\Service\ContactSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Search\Service\ProfileSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Acl\Assertion\Address" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Profile" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Facebook" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Note" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Phone" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Selection" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\ContactAssertion" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\LeaveAssertion" => "Application\Factory\InvokableFactory"
      "Quality\Service\QualityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\Navigation\Invokable\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\SourceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\PhaseLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\YearLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\KpiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\PhaseFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\YearFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\KpiFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\TargetFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\Provider\ProjectProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Provider\Version\VersionProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Acl\Assertion\ChangeRequest\CostChange" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Country" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Process" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Description\Description" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Document\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool\Session" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Idea" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Image" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Partner" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Video" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Poster\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Item" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WorkpackageDescription" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Report" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WindowAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Window\ProjectAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Result\Result" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Version" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Task" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Workpackage" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResultAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\LinkAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\DocumentAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Action" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Pca" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Help" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\HelpFaq" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Log" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Project" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Rationale" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Roadmap" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Calendar\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Project\Service\ProjectService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\KeywordService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AchievementService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Achievement\ExploitableResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionDocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Report\WindowService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\WorkpackageService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ContractService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DescriptionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\IdeaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\Tool\SessionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\HelpService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\InviteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ChangeRequestService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ActionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AwardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\EventService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\ProjectForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\Deliverable\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DeliverableFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\TaskFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AchievementFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\ExploitableResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ProjectFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Action\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AwardFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Award\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CostChangeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Document\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Description\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Event\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\ReportFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\WorkpackageDescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\RationaleFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\Version\VersionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\IdeaFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\ToolFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Description\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Tool\SessionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\FeeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\LogFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\HelpFilter" => "Application\Factory\InputFilterFactory"
      "Project\Options\ModuleOptions" => "Project\Factory\ModuleOptionsFactory"
      "Project\Navigation\Service\HelpNavigationService" => "Project\Navigation\Factory\HelpNavigationServiceFactory"
      "Project\Navigation\Invokable\AchievementLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinkLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinksLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Link\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Document\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\AwardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Award\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CostChangeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\RationaleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Document\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ContractLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Contract\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\FeeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpFaqLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\IdeaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\ToolLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Tool\SessionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Description\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PartnerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Meeting\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Poster\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\ItemLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WorkpackageDescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\Type\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Version\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\WorkpackageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\TaskLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DeliverableLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CalendarReviewLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Search\Service\AchievementSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\Achievement\ExploitableResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\IdeaSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\DescriptionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ProjectSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\WorkpackageDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ActionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Acl\Assertion\FeedbackAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\EvaluationAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReportAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\InputFilter\Report\Criterion\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TopicFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\Service\EvaluationReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\EvaluationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewRosterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewerService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\CriterionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Reviewer\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluateProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\FeedbackLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Options\ModuleOptions" => "Evaluation\Options\Factory\ModuleOptionsFactory"
      "Press\Service\PressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Search\Service\PressSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Press\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Press\Navigation\Invokable\BureauLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Service\ProgramService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\Service\CallService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\ProgramFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\FunderFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CallFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Program\Options\ModuleOptions" => "Program\Factory\ModuleOptionsFactory"
      "Program\Acl\Assertion\Doa" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Funder" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Nda" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Call\Country" => "Application\Factory\InvokableFactory"
      "Program\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Program\Navigation\Invokable\CallLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\FunderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\NdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\ProgramLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\UploadNdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Search\Command\UpdateIndex" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Search\Service\ConsoleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\AdminService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\QueueService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\ApiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\OAuth2Service" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\InputFilter\AccessFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Navigation\Invokable\AccessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ClientLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ScopeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\EntityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\RoleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\SetterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Api\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\QueueLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Provider\AffiliationProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\AffiliationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\QuestionnaireService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\DoaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\LoiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\InputFilter\AffiliationFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\Options\ModuleOptions" => "Affiliation\Factory\ModuleOptionsFactory"
      "Affiliation\Acl\Assertion\AffiliationAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\LoiAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\QuestionnaireAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Navigation\Invokable\AffiliationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\LoiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionnaireLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Options\ModuleOptions" => "Organisation\Factory\ModuleOptionsFactory"
      "Organisation\Form\OrganisationForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\CityForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\SolutionForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\UpdateForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\FinancialForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\OrganisationService" => "Application\Factory\InvokableFactory"
      "Organisation\Service\UpdateService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\BoardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\CityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\SolutionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\ParentService" => "Application\Factory\InvokableFactory"
      "Organisation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\BoardFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\OrganisationFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\ParentEntityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\Parent\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\CityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\SolutionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\Acl\Assertion\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\NoteAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\ParentAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\UpdateAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\FinancialAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\CityAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\SolutionAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Search\Service\OrganisationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Navigation\Invokable\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\BoardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\ParentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\UpdateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\FinancialLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\CityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\SolutionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Service\PublicationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\InputFilter\PublicationFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Publication\Search\Service\PublicationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\Acl\Assertion\Publication" => "Application\Factory\InvokableFactory"
      "Publication\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Publication\Navigation\Invokable\PublicationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeCategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Command\DailyUpdate" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Command\Sync" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\TransactionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\InvoiceService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Options\ModuleOptions" => "Invoice\Factory\ModuleOptionsFactory"
      "Invoice\Search\Service\InvoiceSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Acl\Assertion\Invoice" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Journal" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Method" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Pdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Reminder" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\ReminderPdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Row" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Transaction" => "Application\Factory\InvokableFactory"
      "Invoice\Navigation\Invokable\InvoiceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\JournalLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\TransactionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\ReminderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\RowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\VatDimensionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Deeplink\Service\DeeplinkService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\InputFilter\TargetFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Command\CancelPaymentPending" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Command\UpdateRegistrations" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Navigation\Invokable\BoothLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BoothSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskCostsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\CouponLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationDeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingQuotaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingFloorplanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\TicketLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Service\BadgeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\BoothService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\RegistrationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionFloorplanService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionSpecService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\InputFilter\Badge\AttachmentFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\DeskCostsFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\QuotaFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\OptionCostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\ExhibitionFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\SpecFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Booth\BoothFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\RegistrationFilter" => "Application\Factory\InputFilterFactory"
      "Event\Options\ModuleOptions" => "Event\Factory\ModuleOptionsFactory"
      "Event\Options\CometChatApiOptions" => "Event\Factory\CometChatApiOptionsFactory"
      "Event\Search\Service\RegistrationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Acl\Assertion\Badge" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Booth" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\BoothSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Exhibition" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\ExhibitionSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Meeting" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\MeetingFloorplan" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Registration" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Ticket" => "Application\Factory\InvokableFactory"
      "Calendar\Service\CalendarService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Options\ModuleOptions" => "Calendar\Factory\ModuleOptionsFactory"
      "Calendar\Acl\Assertion\Calendar" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Document" => "Application\Factory\InvokableFactory"
      "Calendar\Search\Service\CalendarSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Navigation\Invokable\CalendarLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Calendar\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Command\FlushQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Command\SendQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Service\MailingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\MailingFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\SenderFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Navigation\Invokable\MailingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\SenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "LaminasGoogleAnalytics\Analytics\Tracker" => "LaminasGoogleAnalytics\Service\TrackerFactory"
      "LaminasGoogleAnalytics\Service\ScriptFactory" => "LaminasGoogleAnalytics\Service\ScriptFactory"
      "Accounting\Adapter\TwinfieldAdapter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Accounting\Options\ModuleOptions" => "Accounting\Factory\ModuleOptionsFactory"
      "ErrorHeroModule\Listener\Mvc" => "ErrorHeroModule\Listener\MvcFactory"
      "ErrorHeroModule\Handler\Logging" => "ErrorHeroModule\Handler\LoggingFactory"
      "SlmQueue\Job\JobPluginManager" => "SlmQueue\Factory\JobPluginManagerFactory"
      "SlmQueue\Strategy\StrategyPluginManager" => "SlmQueue\Factory\StrategyPluginManagerFactory"
      "SlmQueue\Queue\QueuePluginManager" => "SlmQueue\Factory\QueuePluginManagerFactory"
      "SlmQueue\Worker\WorkerPluginManager" => "SlmQueue\Factory\WorkerPluginManagerFactory"
      "SlmQueue\Command\StartWorkerCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
      "SlmQueueDoctrine\Command\RecoverJobsCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
    ]
    "aliases" => array:81 [
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "navigation" => "Laminas\Navigation\Navigation"
      "Zend\Navigation\Navigation" => "Laminas\Navigation\Navigation"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
      "ZF\Apigility\MvcAuth\UnauthenticatedListener" => "Laminas\ApiTools\MvcAuth\UnauthenticatedListener"
      "ZF\Apigility\MvcAuth\UnauthorizedListener" => "Laminas\ApiTools\MvcAuth\UnauthorizedListener"
      "ZF\Apigility\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\ApiFactory"
      "ZF\Apigility\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy"
      "Laminas\ApiTools\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "Laminas\ApiTools\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "Laminas\ApiTools\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "Laminas\ApiTools\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\ApiProblemListener"
      "ZF\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\RenderErrorListener"
      "ZF\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\ApiProblemRenderer"
      "ZF\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\ApiProblemStrategy"
      "ZF\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "ZF\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "ZF\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener"
      "ZF\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "ZF\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\ConfigResource"
      "ZF\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\ConfigResourceFactory"
      "ZF\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\ConfigWriter"
      "ZF\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\ModuleUtils"
      "Laminas\ApiTools\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId"
      "ZF\OAuth2\Adapter\PdoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
      "ZF\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter"
      "ZF\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\OAuth2\Service\OAuth2Server"
      "authentication" => "Laminas\ApiTools\MvcAuth\Authentication"
      "authorization" => "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface"
      "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface" => "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization"
      "ZF\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkExtractor"
      "ZF\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor"
      "ZF\Hal\HalConfig" => "Laminas\ApiTools\Hal\HalConfig"
      "ZF\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\JsonRenderer"
      "ZF\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\JsonStrategy"
      "ZF\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Link\LinkUrlBuilder"
      "ZF\Hal\MetadataMap" => "Laminas\ApiTools\Hal\MetadataMap"
      "ZF\Hal\RendererOptions" => "Laminas\ApiTools\Hal\RendererOptions"
      "ZF\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\AcceptListener"
      "ZF\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\ContentTypeListener"
      "ZF\Versioning\VersionListener" => "Laminas\ApiTools\Versioning\VersionListener"
      "mime_resolver" => "AssetManager\Service\MimeResolver"
      "AssetManager\Service\AggregateResolver" => "AssetManager\Resolver\AggregateResolver"
      "ZfcTwigExtension" => "ZfcTwig\Twig\Extension"
      "ZfcTwigLoaderChain" => "Twig\Loader\ChainLoader"
      "ZfcTwigLoaderTemplateMap" => "ZfcTwig\Twig\MapLoader"
      "ZfcTwigLoaderTemplatePathStack" => "ZfcTwig\Twig\StackLoader"
      "ZfcTwigRenderer" => "ZfcTwig\View\TwigRenderer"
      "ZfcTwigResolver" => "ZfcTwig\View\TwigResolver"
      "ZfcTwigViewHelperManager" => "ZfcTwig\View\HelperPluginManager"
      "ZfcTwigViewStrategy" => "ZfcTwig\View\TwigStrategy"
      "bjyauthorize_zend_db_adapter" => "Laminas\Db\Adapter\Adapter"
      "BjyAuthorize\Service\Authorize" => "Jield\Authorize\Service\AuthorizeService"
      "BjyAuthorize\Cache" => "Laminas\Cache\Storage\Adapter\Redis"
      "google-analytics" => "LaminasGoogleAnalytics\Analytics\Tracker"
      "google-analytics-universal" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "google-analytics-ga" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "delegators" => array:2 [
      "ViewHelperManager" => array:1 [ …1]
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => array:1 [ …1]
    ]
    "invokables" => array:44 [
      "Laminas\ApiTools\Rest\RestParametersListener" => "Laminas\ApiTools\Rest\Listener\RestParametersListener"
      "AssetManager\Service\MimeResolver" => "AssetManager\Service\MimeResolver"
      0 => "BjyAuthorize\View\RedirectionStrategy"
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
      "Content\InputFilter\ArticleFilter" => "Content\InputFilter\ArticleFilter"
      "Content\InputFilter\ContentFilter" => "Content\InputFilter\ContentFilter"
      "Content\InputFilter\ContentParamFilter" => "Content\InputFilter\ContentParamFilter"
      "Content\InputFilter\NodeFilter" => "Content\InputFilter\NodeFilter"
      "Content\InputFilter\ParamFilter" => "Content\InputFilter\ParamFilter"
      1 => "General\InputFilter\PasswordFilter"
      2 => "Cluster\Provider\ClusterProvider"
      3 => "News\InputFilter\NewsFilter"
      4 => "News\InputFilter\BlogFilter"
      5 => "News\InputFilter\Blog\MessageFilter"
      6 => "News\InputFilter\Magazine\ArticleFilter"
      7 => "Press\InputFilter\ArticleFilter"
      8 => "Press\InputFilter\BureauFilter"
      9 => "Program\InputFilter\Call\CallFilter"
      10 => "Program\InputFilter\Call\CountryFilter"
      11 => "Program\InputFilter\DoaFilter"
      12 => "Program\InputFilter\FunderFilter"
      13 => "Admin\InputFilter\Permit\RoleFilter"
      14 => "Organisation\InputFilter\NoteFilter"
      15 => "Invoice\InputFilter\InvoiceFilter"
      16 => "Invoice\InputFilter\RowFilter"
      "Calendar\InputFilter\CalendarFilter" => "Calendar\InputFilter\CalendarFilter"
      "Calendar\InputFilter\DocumentFilter" => "Calendar\InputFilter\DocumentFilter"
      "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "LaminasGoogleAnalytics\View\Helper\Script\Gajs" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "initializers" => array:1 [
      0 => "BjyAuthorize\Service\AuthorizeAwareServiceInitializer"
    ]
    "shared" => array:1 [
      "Contact\Service\ContactService" => false
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:15 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
      "cluster:update-project" => "Cluster\Command\UpdateProject"
      "cluster:generate-project-json" => "Cluster\Command\GenerateProjectJson"
      "contact:cleanup" => "Contact\Command\Cleanup"
      "contact:reset-access" => "Contact\Command\ResetAccess"
      "search:update-index" => "Search\Command\UpdateIndex"
      "organisation:cleanup" => "Organisation\Command\Cleanup"
      "invoice:sync" => "Invoice\Command\Sync"
      "invoice:daily-update" => "Invoice\Command\DailyUpdate"
      "event:update-registrations" => "Event\Command\UpdateRegistrations"
      "event:cancel-payment-pending" => "Event\Command\CancelPaymentPending"
      "mailing:send-queue" => "Mailing\Command\SendQueue"
      "mailing:flush-queue" => "Mailing\Command\FlushQueue"
      "slm-queue:start" => "SlmQueue\Command\StartWorkerCommand"
      "slm-queue:doctrine:recover" => "SlmQueueDoctrine\Command\RecoverJobsCommand"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:28 [
      "api-tools" => array:4 [ …4]
      "oauth" => array:4 [ …4]
      "api" => array:4 [ …4]
      "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
      "doctrine_orm_module_yuml" => array:2 [ …2]
      "zfcadmin" => array:5 [ …5]
      "home" => array:3 [ …3]
      "my" => array:3 [ …3]
      "redirect" => array:5 [ …5]
      "image" => array:4 [ …4]
      "country" => array:5 [ …5]
      "impact-stream" => array:5 [ …5]
      "challenge" => array:4 [ …4]
      "email" => array:5 [ …5]
      "community" => array:5 [ …5]
      "magazine" => array:4 [ …4]
      "annual-report" => array:4 [ …4]
      "json" => array:4 [ …4]
      "assets" => array:4 [ …4]
      "project" => array:5 [ …5]
      "press" => array:4 [ …4]
      "search" => array:3 [ …3]
      "oauth2" => array:4 [ …4]
      "user" => array:5 [ …5]
      "organisation" => array:5 [ …5]
      "publication" => array:5 [ …5]
      "deeplink" => array:3 [ …3]
      "error-preview" => array:2 [ …2]
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:504 [
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "agacceptheaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agcontenttypeheaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agservicepath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agstatuscodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agtransformdescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "agTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "ZF\Apigility\Documentation\View\AgAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "ZF\Apigility\Documentation\View\AgContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "ZF\Apigility\Documentation\View\AgServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "ZF\Apigility\Documentation\View\AgStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "ZF\Apigility\Documentation\View\AgTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "asset" => "AssetManager\View\Helper\Asset"
      "nodeLink" => "Content\View\Helper\NodeLink"
      "paramLink" => "Content\View\Helper\ParamLink"
      "handlerLink" => "Content\View\Helper\HandlerLink"
      "segmentLink" => "Content\View\Helper\SegmentLink"
      "templateLink" => "Content\View\Helper\TemplateLink"
      "contentLink" => "Content\View\Helper\ContentLink"
      "routeLink" => "Content\View\Helper\RouteLink"
      "topicLink" => "Content\View\Helper\TopicLink"
      "articleLink" => "Content\View\Helper\ArticleLink"
      "nodeTableRow" => "Content\View\Helper\NodeTableRow"
      "imageLink" => "Content\View\Helper\ImageLink"
      "image" => "Content\View\Helper\Image"
      "videoLink" => "Content\View\Helper\VideoLink"
      "video" => "Content\View\Helper\Video"
      "paginationLink" => "Content\View\Helper\PaginationLink"
      "imageHandler" => "Content\View\Handler\ImageHandler"
      "contentHandler" => "Content\View\Handler\ContentHandler"
      "buildNavigation" => "Content\View\Helper\BuildNavigation"
      "challengeHandler" => "General\View\Handler\ChallengeHandler"
      "challengeIcon" => "General\View\Helper\Challenge\ChallengeIcon"
      "challengeImage" => "General\View\Helper\Challenge\ChallengeImage"
      "challengeIdeaPosterImage" => "General\View\Helper\Challenge\Idea\Poster\Image"
      "challengeIdeaPosterIcon" => "General\View\Helper\Challenge\Idea\Poster\Icon"
      "challengeTypeLink" => "General\View\Helper\Challenge\TypeLink"
      "countryMap" => "General\View\Helper\Country\CountryMap"
      "countryFlag" => "General\View\Helper\Country\CountryFlag"
      "countryLink" => "General\View\Helper\Country\CountryLink"
      "countryVideoLink" => "General\View\Helper\Country\VideoLink"
      "languageLink" => "General\View\Helper\LanguageLink"
      "currencyLink" => "General\View\Helper\CurrencyLink"
      "exchangeRateLink" => "General\View\Helper\ExchangeRateLink"
      "passwordLink" => "General\View\Helper\PasswordLink"
      "emailMessageLink" => "General\View\Helper\EmailMessageLink"
      "generalLogLink" => "General\View\Helper\LogLink"
      "vatLink" => "General\View\Helper\VatLink"
      "genderLink" => "General\View\Helper\GenderLink"
      "titleLink" => "General\View\Helper\TitleLink"
      "vatTypeLink" => "General\View\Helper\VatTypeLink"
      "challengeLink" => "General\View\Helper\Challenge\ChallengeLink"
      "webInfoLink" => "General\View\Helper\WebInfoLink"
      "contentTypeLink" => "General\View\Helper\ContentTypeLink"
      "contentTypeIcon" => "General\View\Helper\ContentTypeIcon"
      "countryselect" => "General\Form\View\Helper\CountrySelect"
      "clusterLink" => "Cluster\View\Helper\ClusterLink"
      "clusterLogo" => "Cluster\View\Helper\Cluster\Logo"
      "blogLink" => "News\View\Helper\BlogLink"
      "blogMessageLink" => "News\View\Helper\Blog\MessageLink"
      "blogTagLink" => "News\View\Helper\Blog\TagLink"
      "blogCategoryLink" => "News\View\Helper\Blog\CategoryLink"
      "newsLink" => "News\View\Helper\NewsLink"
      "newsCategoryLink" => "News\View\Helper\News\CategoryLink"
      "magazineLink" => "News\View\Helper\MagazineLink"
      "magazineArticleLink" => "News\View\Helper\Magazine\ArticleLink"
      "blogselect" => "News\Form\View\Helper\BlogSelect"
      "contactLink" => "Contact\View\Helper\ContactLink"
      "officeContactLink" => "Contact\View\Helper\Office\ContactLink"
      "leaveLink" => "Contact\View\Helper\Office\LeaveLink"
      "dndLink" => "Contact\View\Helper\DndLink"
      "profileLink" => "Contact\View\Helper\ProfileLink"
      "selectionLink" => "Contact\View\Helper\SelectionLink"
      "selectionTypeLink" => "Contact\View\Helper\Selection\TypeLink"
      "facebookLink" => "Contact\View\Helper\FacebookLink"
      "optInLink" => "Contact\View\Helper\OptInLink"
      "addressLink" => "Contact\View\Helper\AddressLink"
      "noteLink" => "Contact\View\Helper\NoteLink"
      "phoneLink" => "Contact\View\Helper\PhoneLink"
      "contactPhoto" => "Contact\View\Helper\ContactPhoto"
      "contactformelement" => "Contact\Form\View\Helper\ContactFormElement"
      "selectionformelement" => "Contact\Form\View\Helper\SelectionFormElement"
      "qualityActionLink" => "Quality\View\Helper\ActionLink"
      "qualityProcessLink" => "Quality\View\Helper\ProcessLink"
      "qualityStatusLink" => "Quality\View\Helper\StatusLink"
      "qualityStatusBadge" => "Quality\View\Helper\StatusBadge"
      "qualityPhaseLink" => "Quality\View\Helper\PhaseLink"
      "qualityYearLink" => "Quality\View\Helper\YearLink"
      "qualityTargetLink" => "Quality\View\Helper\TargetLink"
      "qualityKpiLink" => "Quality\View\Helper\KpiLink"
      "qualityKpiTargetLink" => "Quality\View\Helper\Kpi\TargetLink"
      "qualityKpiGroupLink" => "Quality\View\Helper\Kpi\GroupLink"
      "qualityKpiResultLink" => "Quality\View\Helper\Kpi\ResultLink"
      "qualityKpiResultMatrix" => "Quality\View\Helper\Kpi\Result\Matrix"
      "qualityActionSourceLink" => "Quality\View\Helper\Action\SourceLink"
      "qualityActionGroupLink" => "Quality\View\Helper\Action\GroupLink"
      "qualityActionResultMatrix" => "Quality\View\Helper\Action\Result\Matrix"
      "projectLogo" => "Project\View\Helper\Project\ProjectLogo"
      "projectQuickstart" => "Project\View\Helper\Project\Quickstart"
      "projectStatusIcon" => "Project\View\Helper\Project\StatusIcon"
      "projectDates" => "Project\View\Helper\Project\ProjectDates"
      "projectInviteLink" => "Project\View\Helper\Project\InviteLink"
      "projectSelectionLink" => "Project\View\Helper\SelectionLink"
      "ideaImage" => "Project\View\Helper\Idea\IdeaImage"
      "toolSessionLink" => "Project\View\Helper\Idea\Tool\SessionLink"
      "helpLink" => "Project\View\Helper\HelpLink"
      "logLink" => "Project\View\Helper\LogLink"
      "pcaLink" => "Project\View\Helper\PcaLink"
      "helpFaqLink" => "Project\View\Helper\HelpFaqLink"
      "projectLink" => "Project\View\Helper\Project\ProjectLink"
      "documentLink" => "Project\View\Helper\Document\DocumentLink"
      "documentTypeLink" => "Project\View\Helper\Document\TypeLink"
      "versionLink" => "Project\View\Helper\Version\VersionLink"
      "versionDocumentLink" => "Project\View\Helper\Version\DocumentLink"
      "versionReviewerLink" => "Project\View\Helper\Version\ReviewerLink"
      "resultCategoryLink" => "Project\View\Helper\Result\CategoryLink"
      "resultTypeLink" => "Project\View\Helper\Result\TypeLink"
      "resultLink" => "Project\View\Helper\ResultLink"
      "reportLink" => "Project\View\Helper\Report\ReportLink"
      "reportHelper" => "Project\View\Helper\Report\ReportHelper"
      "reportItemLink" => "Project\View\Helper\Report\ItemLink"
      "reportReviewerLink" => "Project\View\Helper\Report\ReviewerLink"
      "projectReportWindowLink" => "Project\View\Helper\Report\WindowLink"
      "projectReportWindowProjectLink" => "Project\View\Helper\Report\Window\ProjectLink"
      "reportWorkpackageDescriptionLink" => "Project\View\Helper\Report\WorkpackageDescriptionLink"
      "workpackageLink" => "Project\View\Helper\Workpackage\WorkpackageLink"
      "workpackageDocumentLink" => "Project\View\Helper\Workpackage\DocumentLink"
      "workpackageTaskLink" => "Project\View\Helper\Workpackage\TaskLink"
      "workpackageDeliverableLink" => "Project\View\Helper\Workpackage\DeliverableLink"
      "workpackageDescriptionLink" => "Project\View\Helper\Workpackage\DescriptionLink"
      "workpackageDeliverableDocumentLink" => "Project\View\Helper\Workpackage\Deliverable\DocumentLink"
      "workpackageDeliverableTypeLink" => "Project\View\Helper\Workpackage\Deliverable\TypeLink"
      "posterLink" => "Project\View\Helper\PosterLink"
      "feeLink" => "Project\View\Helper\FeeLink"
      "ideaLink" => "Project\View\Helper\Idea\IdeaLink"
      "ideaToolLink" => "Project\View\Helper\Idea\ToolLink"
      "ideaInviteLink" => "Project\View\Helper\Idea\InviteLink"
      "ideaDescriptionLink" => "Project\View\Helper\Idea\DescriptionLink"
      "ideaPartnerLink" => "Project\View\Helper\Idea\PartnerLink"
      "ideaPosterLink" => "Project\View\Helper\Idea\PosterLink"
      "ideaPosterAttachment" => "Project\View\Helper\Idea\Poster\Attachment"
      "ideaPosterThumbnail" => "Project\View\Helper\Idea\Poster\Thumbnail"
      "ideaDocumentLink" => "Project\View\Helper\Idea\DocumentLink"
      "ideaImageLink" => "Project\View\Helper\Idea\ImageLink"
      "ideaVideoLink" => "Project\View\Helper\Idea\VideoLink"
      "ideaMeetingLink" => "Project\View\Helper\Idea\MeetingLink"
      "ideaMeetingInviteLink" => "Project\View\Helper\Idea\Meeting\InviteLink"
      "ideaMessageLink" => "Project\View\Helper\Idea\MessageLink"
      "ideaMessageDocumentLink" => "Project\View\Helper\Idea\Message\DocumentLink"
      "ideaStatusLink" => "Project\View\Helper\Idea\StatusLink"
      "ideaStatusDocumentLink" => "Project\View\Helper\Idea\Status\DocumentLink"
      "ideaDescriptionTypeLink" => "Project\View\Helper\Idea\Description\TypeLink"
      "buildHelp" => "Project\View\Helper\BuildHelp"
      "descriptionLink" => "Project\View\Helper\DescriptionLink"
      "buildDescription" => "Project\View\Helper\Description\BuildTree"
      "buildDescriptionNavigation" => "Project\View\Helper\Description\BuildNavigation"
      "buildDescriptionContent" => "Project\View\Helper\Description\BuildContent"
      "rationaleLink" => "Project\View\Helper\RationaleLink"
      "achievementLink" => "Project\View\Helper\Achievement\AchievementLink"
      "achievementTypeLink" => "Project\View\Helper\Achievement\TypeLink"
      "achievementCategoryLink" => "Project\View\Helper\Achievement\CategoryLink"
      "achievementExploitableResultLink" => "Project\View\Helper\Achievement\ExploitableResultLink"
      "achievementExploitableResultLinkLink" => "Project\View\Helper\Achievement\ExploitableResult\LinkLink"
      "achievementExploitableResultDocumentLink" => "Project\View\Helper\Achievement\ExploitableResult\DocumentLink"
      "changeRequestProcessLink" => "Project\View\Helper\ChangeRequest\ProcessLink"
      "changeRequestCostChangeLink" => "Project\View\Helper\ChangeRequest\CostChangeLink"
      "changeRequestCountryLink" => "Project\View\Helper\ChangeRequest\CountryLink"
      "projectCalendarReviewerLink" => "Project\View\Helper\Project\CalendarReviewerLink"
      "projectContractLink" => "Project\View\Helper\Contract\ContractLink"
      "contractDocumentLink" => "Project\View\Helper\Contract\DocumentLink"
      "contractVersionLink" => "Project\View\Helper\Contract\VersionLink"
      "contractVersionDocumentLink" => "Project\View\Helper\Contract\VersionDocumentLink"
      "actionLink" => "Project\View\Helper\Action\ActionLink"
      "actionTypeLink" => "Project\View\Helper\Action\TypeLink"
      "awardLink" => "Project\View\Helper\Award\AwardLink"
      "awardTypeLink" => "Project\View\Helper\Award\TypeLink"
      "eventLink" => "Project\View\Helper\EventLink"
      "eventTypeLink" => "Project\View\Helper\EventTypeLink"
      "projectformelement" => "Project\Form\View\Helper\ProjectFormElement"
      "resultselect" => "Project\Form\View\Helper\ResultSelect"
      "feedbackLink" => "Evaluation\View\Helper\FeedbackLink"
      "evaluationLink" => "Evaluation\View\Helper\EvaluationLink"
      "evaluationReportLink" => "Evaluation\View\Helper\ReportLink"
      "evaluationReportDownloadLink" => "Evaluation\View\Helper\Report\DownloadLink"
      "evaluationReportPresentationLink" => "Evaluation\View\Helper\Report\PresentationLink"
      "evaluationReportFinalLink" => "Evaluation\View\Helper\Report\FinalLink"
      "evaluationReportProgress" => "Evaluation\View\Helper\Report\Progress"
      "evaluationReportScore" => "Evaluation\View\Helper\Report\Score"
      "reportVersionLink" => "Evaluation\View\Helper\Report\VersionLink"
      "reportWindowLink" => "Evaluation\View\Helper\Report\WindowLink"
      "reportCriterionLink" => "Evaluation\View\Helper\Report\CriterionLink"
      "reportCriterionCategoryLink" => "Evaluation\View\Helper\Report\Criterion\CategoryLink"
      "reportCriterionTypeLink" => "Evaluation\View\Helper\Report\Criterion\TypeLink"
      "reportCriterionTopicLink" => "Evaluation\View\Helper\Report\Criterion\TopicLink"
      "reportCriterionVersionLink" => "Evaluation\View\Helper\Report\Criterion\VersionLink"
      "reviewerLink" => "Evaluation\View\Helper\ReviewerLink"
      "reviewerContactLink" => "Evaluation\View\Helper\Reviewer\ContactLink"
      "pressArticleLink" => "Press\View\Helper\ArticleLink"
      "bureauLink" => "Press\View\Helper\BureauLink"
      "programHandler" => "Program\View\Handler\ProgramHandler"
      "callInformationBox" => "Program\View\Helper\CallInformationBox"
      "programLink" => "Program\View\Helper\ProgramLink"
      "programDoaLink" => "Program\View\Helper\DoaLink"
      "callLink" => "Program\View\Helper\CallLink"
      "ndaLink" => "Program\View\Helper\NdaLink"
      "funderLink" => "Program\View\Helper\FunderLink"
      "callCountryLink" => "Program\View\Helper\CallCountryLink"
      "accessLink" => "Admin\View\Helper\AccessLink"
      "permitEntityLink" => "Admin\View\Helper\Permit\EntityLink"
      "permitRoleLink" => "Admin\View\Helper\Permit\RoleLink"
      "permitSetterLink" => "Admin\View\Helper\Permit\SetterLink"
      "queueLink" => "Admin\View\Helper\QueueLink"
      "oauth2clientlink" => "Admin\View\Helper\OAuth2\ClientLink"
      "oauth2scopelink" => "Admin\View\Helper\OAuth2\ScopeLink"
      "apiLogLink" => "Admin\View\Helper\Api\LogLink"
      "accessformelement" => "Admin\Form\View\Helper\AccessFormElement"
      "ztbalert" => "lbs5alert"
      "ztbformelement" => "lbs5formelement"
      "filterbarelement" => "lbs5filterbarelement"
      "lbs5navigation" => "LaminasBootstrap5\View\Helper\Navigation"
      "lbs5filterbarelement" => "LaminasBootstrap5\Form\View\Helper\FilterBarElement"
      "lbs5filtercolumnelement" => "LaminasBootstrap5\Form\View\Helper\FilterColumnElement"
      "lbs5formelement" => "LaminasBootstrap5\Form\View\Helper\FormElement"
      "lbs5formcheckbox" => "LaminasBootstrap5\Form\View\Helper\FormCheckbox"
      "associateLink" => "Affiliation\View\Helper\AssociateLink"
      "affiliationLink" => "Affiliation\View\Helper\AffiliationLink"
      "affiliationDoaLink" => "Affiliation\View\Helper\DoaLink"
      "affiliationLoiLink" => "Affiliation\View\Helper\LoiLink"
      "paymentSheet" => "Affiliation\View\Helper\PaymentSheet"
      "affiliationEffortSpentLink" => "Affiliation\View\Helper\EffortSpentLink"
      "affiliationQuestionCategoryLink" => "Affiliation\View\Helper\Questionnaire\CategoryLink"
      "affiliationQuestionLink" => "Affiliation\View\Helper\Questionnaire\QuestionLink"
      "affiliationQuestionnaireLink" => "Affiliation\View\Helper\Questionnaire\QuestionnaireLink"
      "questionnaireHelper" => "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper"
      "organisationLink" => "Organisation\View\Helper\OrganisationLink"
      "organisationTypeLink" => "Organisation\View\Helper\Organisation\TypeLink"
      "organisationLogo" => "Organisation\View\Helper\OrganisationLogo"
      "organisationNoteLink" => "Organisation\View\Helper\NoteLink"
      "boardLink" => "Organisation\View\Helper\BoardLink"
      "organisationSelectionLink" => "Organisation\View\Helper\SelectionLink"
      "parentLink" => "Organisation\View\Helper\Parent\ParentLink"
      "parentOrganisationLink" => "Organisation\View\Helper\Parent\OrganisationLink"
      "parentDoaLink" => "Organisation\View\Helper\Parent\DoaLink"
      "parentTypeLink" => "Organisation\View\Helper\Parent\TypeLink"
      "parentFinancialLink" => "Organisation\View\Helper\Parent\FinancialLink"
      "advisoryBoardCityLink" => "Organisation\View\Helper\AdvisoryBoard\CityLink"
      "advisoryBoardCityImage" => "Organisation\View\Helper\AdvisoryBoard\CityImage"
      "advisoryBoardSolutionLink" => "Organisation\View\Helper\AdvisoryBoard\SolutionLink"
      "advisoryBoardSolutionImage" => "Organisation\View\Helper\AdvisoryBoard\SolutionImage"
      "organisationUpdateLink" => "Organisation\View\Helper\UpdateLink"
      "organisationUpdateLogo" => "Organisation\View\Helper\UpdateLogo"
      "organisationUpdateNotification" => "Organisation\View\Helper\UpdateNotification"
      "overviewVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution"
      "overviewExtraVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution"
      "organisationselect" => "Organisation\Form\View\Helper\OrganisationFormElement"
      "parentformelement" => "Organisation\Form\View\Helper\ParentFormElement"
      "publicationLink" => "Publication\View\Helper\PublicationLink"
      "publicationTypeLink" => "Publication\View\Helper\TypeLink"
      "publicationCategoryLink" => "Publication\View\Helper\CategoryLink"
      "invoiceLink" => "Invoice\View\Helper\InvoiceLink"
      "transactionLink" => "Invoice\View\Helper\TransactionLink"
      "invoiceRowLink" => "Invoice\View\Helper\RowLink"
      "dimensionLink" => "Invoice\View\Helper\DimensionLink"
      "invoicePdfLink" => "Invoice\View\Helper\PdfLink"
      "invoiceWordLink" => "Invoice\View\Helper\WordLink"
      "reminderLink" => "Invoice\View\Helper\ReminderLink"
      "reminderInvoiceOverview" => "Invoice\View\Helper\ReminderInvoiceOverview"
      "journalLink" => "Invoice\View\Helper\JournalLink"
      "dailyUpdateHandler" => "Invoice\View\Helper\DailyUpdateHandler"
      "canAssemble" => "Deeplink\View\Helper\CanAssemble"
      "deeplinkLink" => "Deeplink\View\Helper\DeeplinkLink"
      "deeplinkTargetLink" => "Deeplink\View\Helper\Deeplink\TargetLink"
      "deskCostsLink" => "Event\View\Helper\DeskCostsLink"
      "meetingLink" => "Event\View\Helper\Meeting\MeetingLink"
      "meetingOptionLink" => "Event\View\Helper\Meeting\OptionLink"
      "meetingOptionCostLink" => "Event\View\Helper\Meeting\OptionCostLink"
      "meetingCostLink" => "Event\View\Helper\Meeting\CostLink"
      "meetingQuotaLink" => "Event\View\Helper\Meeting\QuotaLink"
      "meetingCouponLink" => "Event\View\Helper\CouponLink"
      "boothLink" => "Event\View\Helper\Booth\BoothLink"
      "boothSpecLink" => "Event\View\Helper\Booth\SpecLink"
      "exhibitionLink" => "Event\View\Helper\Exhibition\ExhibitionLink"
      "registrationLink" => "Event\View\Helper\RegistrationLink"
      "meetingFloorplanLink" => "Event\View\Helper\Meeting\FloorplanLink"
      "exhibitionSpecLink" => "Event\View\Helper\Exhibition\SpecLink"
      "exhibitionCostLink" => "Event\View\Helper\Exhibition\CostLink"
      "badgeLink" => "Event\View\Helper\Badge\BadgeLink"
      "badgeAttachmentLink" => "Event\View\Helper\Badge\AttachmentLink"
      "badgeImage" => "Event\View\Helper\Badge\Image"
      "badgeContactLink" => "Event\View\Helper\Badge\ContactLink"
      "ticketImage" => "Event\View\Helper\Ticket\Image"
      "ticketLink" => "Event\View\Helper\Ticket\TicketLink"
      "calendarDocumentLink" => "Calendar\View\Helper\DocumentLink"
      "calendarTypeLink" => "Calendar\View\Helper\TypeLink"
      "calendarLink" => "Calendar\View\Helper\CalendarLink"
      "mailingLink" => "Mailing\View\Helper\MailingLink"
      "attachmentLink" => "Mailing\View\Helper\AttachmentLink"
      "mailingContactLink" => "Mailing\View\Helper\MailingContactLink"
      "mailingTemplateLink" => "Mailing\View\Helper\TemplateLink"
      "senderLink" => "Mailing\View\Helper\SenderLink"
      "emailMessageEventIcon" => "Mailing\View\Helper\EmailMessageEventIcon"
    ]
    "factories" => array:348 [
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\ApiTools\Documentation\View\AgAcceptHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgServicePath" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgStatusCodes" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgTransformDescription" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Hal" => "Laminas\ApiTools\Hal\Factory\HalViewHelperFactory"
      "AssetManager\View\Helper\Asset" => "AssetManager\Service\AssetViewHelperFactory"
      "isAllowed" => "BjyAuthorize\View\Helper\IsAllowedFactory"
      "Content\View\Helper\NodeLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ParamLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\HandlerLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\SegmentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TemplateLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ContentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\RouteLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TopicLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Image" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Video" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\NodeTableRow" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ImageHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ArticleHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ContentHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\PaginationLink" => "Application\Factory\InvokableFactory"
      "Content\View\Helper\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\ChallengeIcon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\ChallengeImage" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Image" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Icon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Country\CountryFlag" => "General\View\Factory\ImageHelperFactory"
      "General\View\Handler\CountryHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ImpactStreamHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ChallengeHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Challenge\ChallengeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\CurrencyLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ExchangeRateLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\PasswordLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LanguageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\GenderLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\EmailMessageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\TitleLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\WebInfoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ContentTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryMap" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\ContentTypeIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\View\Helper\ClusterLink" => "General\View\Factory\LinkHelperFactory"
      "Cluster\View\Helper\Cluster\Logo" => "General\View\Factory\ImageHelperFactory"
      "News\View\Handler\NewsHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\BlogHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\MagazineHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Helper\BlogLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\TagLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\NewsLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\News\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\MagazineLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Magazine\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\DndLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ProfileLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Selection\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\FacebookLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\OptInLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\AddressLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\NoteLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\PhoneLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactPhoto" => "General\View\Factory\ImageHelperFactory"
      "Contact\View\Helper\Office\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Office\LeaveLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\Form\View\Helper\ContactFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\View\Helper\SelectionFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusBadge" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Quality\View\Helper\PhaseLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\YearLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\KpiLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\Action\SourceLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\View\Helper\ProjectFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ProjectHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ResultHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\IdeaHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectLogo" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Project\Quickstart" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\StatusIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectDates" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaImage" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PcaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpFaqLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\VersionLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Version\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportHelper" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Report\ItemLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\Window\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WorkpackageDescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\WorkpackageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\TaskLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DeliverableLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\FeeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ToolLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PartnerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Description\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MeetingLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Meeting\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Message\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Status\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Poster\Attachment" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Poster\Thumbnail" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Tool\SessionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\BuildHelp" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Description\BuildTree" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildContent" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\RationaleLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\AchievementLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\LinkLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CostChangeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\CalendarReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\ContractLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionDocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\AwardLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventTypeLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\FeedbackLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\EvaluationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\DownloadLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\PresentationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\FinalLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Progress" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\Score" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\CriterionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Criterion\CategoryLink" => "General\View\Factory\LinkHelperFactory"
       …109
    ]
    "invokables" => array:18 [ …18]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:2 [ …2]
  ]
  "controller_plugins" => array:3 [
    "aliases" => array:100 [ …100]
    "factories" => array:89 [ …89]
    "invokables" => array:2 [ …2]
  ]
  "asset_manager" => array:6 [
    "resolver_configs" => array:4 [ …4]
    "clear_output_buffer" => true
    "resolvers" => array:6 [ …6]
    "view_helper" => array:3 [ …3]
    "caching" => array:4 [ …4]
    "filters" => array:2 [ …2]
  ]
  "api-tools" => array:1 [
    "db-connected" => []
  ]
  "controllers" => array:4 [
    "aliases" => array:3 [ …3]
    "factories" => array:330 [ …330]
    "abstract_factories" => array:2 [ …2]
    "invokables" => array:3 [ …3]
  ]
  "api-tools-content-negotiation" => array:6 [
    "controllers" => array:2 [ …2]
    "accept_whitelist" => array:1 [ …1]
    "selectors" => array:3 [ …3]
    "content_type_whitelist" => []
    "x_http_method_override_enabled" => false
    "http_override_methods" => []
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:5 [ …5]
    "display_exceptions" => true
    "template_map" => array:1497 [ …1497]
    "strategies" => array:2 [ …2]
    "display_not_found_reason" => true
    "doctype" => "HTML5"
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
  ]
  "api-tools-api-problem" => []
  "api-tools-configuration" => array:1 [
    "config_file" => "config/autoload/development.php"
  ]
  "api-tools-oauth2" => array:7 [
    "grant_types" => array:5 [ …5]
    "api_problem_error_response" => true
    "storage" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
    "options" => array:6 [ …6]
    "allow_implicit" => true
    "access_lifetime" => 3600
    "enforce_state" => true
  ]
  "api-tools-mvc-auth" => array:2 [
    "authentication" => array:2 [ …2]
    "authorization" => array:2 [ …2]
  ]
  "api-tools-hal" => array:3 [
    "renderer" => []
    "metadata_map" => []
    "options" => array:1 [ …1]
  ]
  "filters" => array:1 [
    "factories" => array:2 [ …2]
  ]
  "validators" => array:2 [
    "factories" => array:8 [ …8]
    "aliases" => array:3 [ …3]
  ]
  "input_filter_specs" => []
  "api-tools-content-validation" => array:1 [
    "methods_without_bodies" => []
  ]
  "api-tools-rest" => array:1 [
    "Api\V1\Rest\ContactResource\MeListener" => array:11 [ …11]
  ]
  "api-tools-rpc" => []
  "api-tools-versioning" => array:3 [
    "content-type" => []
    "default_version" => 1
    "uri" => []
  ]
  "bjyauthorize" => array:12 [
    "guards" => array:1 [ …1]
    "default_role" => "guest"
    "authenticated_role" => "user"
    "identity_provider" => "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider"
    "role_providers" => array:1 [ …1]
    "resource_providers" => []
    "rule_providers" => []
    "unauthorized_strategy" => "Jield\Authorize\View\UnauthorizedStrategy"
    "template" => "error/403"
    "cache_enabled" => true
    "cache_options" => array:2 [ …2]
    "cache_key" => "bjyauthorize_acl"
  ]
  "doctrine" => array:15 [
    "driver" => array:22 [ …22]
    "cache" => array:11 [ …11]
    "authentication" => array:2 [ …2]
    "authenticationadapter" => array:2 [ …2]
    "authenticationstorage" => array:2 [ …2]
    "authenticationservice" => array:2 [ …2]
    "connection" => array:1 [ …1]
    "configuration" => array:1 [ …1]
    "entitymanager" => array:1 [ …1]
    "eventmanager" => array:1 [ …1]
    "sql_logger_collector" => array:1 [ …1]
    "mapping_collector" => array:1 [ …1]
    "entity_resolver" => array:1 [ …1]
    "migrations_configuration" => array:1 [ …1]
    "migrations_cmd" => array:13 [ …13]
  ]
  "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory" => array:608 [
    "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
    "Jield\Authorize\View\UnauthorizedStrategy" => array:2 [ …2]
    "Application\Twig\DatabaseTwigLoader" => array:1 [ …1]
    "Application\Event\SetTitle" => array:2 [ …2]
    "Application\Event\InjectAclInNavigation" => array:2 [ …2]
    "Application\Event\BlockInactiveContact" => array:1 [ …1]
    "Application\Event\RegisterPageview" => array:3 [ …3]
    "Application\Authentication\Storage\AuthenticationStorage" => array:2 [ …2]
    "Laminas\Authentication\AuthenticationService" => array:1 [ …1]
    "Application\Session\SaveHandler\DoctrineGateway" => array:2 [ …2]
    "Content\Controller\Json\ArticleController" => array:1 [ …1]
    "Content\Controller\Json\ImageController" => array:3 [ …3]
    "Content\Controller\Json\NodeController" => array:3 [ …3]
    "Content\Controller\ArticleController" => array:4 [ …4]
    "Content\Controller\ContentController" => array:1 [ …1]
    "Content\Controller\ImageController" => array:4 [ …4]
    "Content\Controller\VideoController" => array:4 [ …4]
    "Content\Controller\NodeController" => array:3 [ …3]
    "Content\Controller\NodeManagerController" => array:4 [ …4]
    "Content\Controller\RedirectController" => array:3 [ …3]
    "Content\Navigation\Service\ContentNavigationService" => array:7 [ …7]
    "Content\InputFilter\HandlerFilter" => array:1 [ …1]
    "Content\InputFilter\RouteFilter" => array:1 [ …1]
    "Content\InputFilter\SegmentFilter" => array:1 [ …1]
    "Content\InputFilter\TemplateFilter" => array:1 [ …1]
    "Content\InputFilter\TopicFilter" => array:1 [ …1]
    "Content\Service\ArticleService" => array:1 [ …1]
    "Content\Service\VimeoService" => array:2 [ …2]
    "Content\Service\RouteService" => array:1 [ …1]
    "Content\Service\ContentService" => array:1 [ …1]
    "Content\Service\NodeService" => array:2 [ …2]
    "Content\View\Helper\BuildNavigation" => array:3 [ …3]
    "Content\View\Helper\NodeTableRow" => array:2 [ …2]
    "Content\View\Helper\Image" => array:3 [ …3]
    "Content\View\Handler\ArticleHandler" => array:8 [ …8]
    "Content\View\Handler\ContentHandler" => array:8 [ …8]
    "Content\View\Handler\ImageHandler" => array:8 [ …8]
    "General\Controller\ChallengeController" => array:4 [ …4]
    "General\Controller\ChallengeTypeController" => array:3 [ …3]
    "General\Controller\ContentTypeController" => array:3 [ …3]
    "General\Controller\LanguageController" => array:3 [ …3]
    "General\Controller\CountryController" => array:4 [ …4]
    "General\Controller\Country\VideoController" => array:3 [ …3]
    "General\Controller\CurrencyController" => array:3 [ …3]
    "General\Controller\EmailController" => array:2 [ …2]
    "General\Controller\ExchangeRateController" => array:3 [ …3]
    "General\Controller\GenderController" => array:3 [ …3]
    "General\Controller\ImageController" => array:2 [ …2]
    "General\Controller\ImpactStreamController" => array:3 [ …3]
    "General\Controller\LogController" => array:3 [ …3]
    "General\Controller\PasswordController" => array:3 [ …3]
    "General\Controller\TitleController" => array:3 [ …3]
    "General\Controller\VatController" => array:3 [ …3]
    "General\Controller\VatTypeController" => array:3 [ …3]
    "General\Controller\WebInfoController" => array:4 [ …4]
    "General\Service\GeneralService" => array:1 [ …1]
    "General\Service\CountryService" => array:3 [ …3]
    "General\View\Handler\ImpactStreamHandler" => array:9 [ …9]
    "General\View\Handler\ChallengeHandler" => array:7 [ …7]
    "General\View\Handler\CountryHandler" => array:9 [ …9]
    "General\View\Helper\ContentTypeIcon" => array:1 [ …1]
    "General\View\Helper\Country\CountryMap" => array:2 [ …2]
    "General\Search\Service\CountrySearchService" => array:1 [ …1]
    "Cluster\Command\UpdateProject" => array:4 [ …4]
    "Cluster\Command\GenerateProjectJson" => array:2 [ …2]
    "Cluster\Controller\Admin\ClusterController" => array:4 [ …4]
    "Cluster\Controller\ImageController" => array:1 [ …1]
    "Cluster\Service\ClusterService" => array:1 [ …1]
    "Cluster\Service\StatisticsService" => array:1 [ …1]
    "Cluster\Form\ClusterForm" => array:1 [ …1]
    "News\Controller\BlogController" => array:4 [ …4]
    "News\Controller\Blog\CategoryController" => array:3 [ …3]
    "News\Controller\Blog\TagController" => array:3 [ …3]
    "News\Controller\Blog\MessageController" => array:3 [ …3]
    "News\Controller\NewsController" => array:4 [ …4]
    "News\Controller\News\CategoryController" => array:3 [ …3]
    "News\Controller\MagazineController" => array:4 [ …4]
    "News\Controller\Magazine\ArticleController" => array:4 [ …4]
    "News\Service\BlogService" => array:4 [ …4]
    "News\Service\NewsService" => array:3 [ …3]
    "News\Service\MagazineService" => array:1 [ …1]
    "News\Search\Service\NewsSearchService" => array:1 [ …1]
    "News\Search\Service\BlogSearchService" => array:1 [ …1]
    "News\View\Handler\NewsHandler" => array:7 [ …7]
    "News\View\Handler\BlogHandler" => array:7 [ …7]
    "News\View\Handler\MagazineHandler" => array:6 [ …6]
    "Contact\Controller\AddressManagerController" => array:3 [ …3]
    "Contact\Controller\ContactAdminController" => array:12 [ …12]
    "Contact\Controller\ContactDetailsController" => array:10 [ …10]
    "Contact\Controller\ContactController" => array:3 [ …3]
    "Contact\Controller\DndController" => array:5 [ …5]
    "Contact\Controller\FacebookController" => array:3 [ …3]
    "Contact\Controller\FacebookManagerController" => array:3 [ …3]
    "Contact\Controller\OptInManagerController" => array:3 [ …3]
    "Contact\Controller\ImageController" => array:1 [ …1]
    "Contact\Controller\NoteManagerController" => array:3 [ …3]
    "Contact\Controller\PhoneManagerController" => array:3 [ …3]
    "Contact\Controller\ProfileController" => array:10 [ …10]
    "Contact\Controller\Selection\ManagerController" => array:7 [ …7]
    "Contact\Controller\Selection\TypeController" => array:3 [ …3]
    "Contact\Controller\Office\ContactController" => array:2 [ …2]
    "Contact\Controller\Office\LeaveController" => array:3 [ …3]
    "Contact\Command\Cleanup" => array:1 [ …1]
    "Contact\Command\ResetAccess" => array:1 [ …1]
    "Contact\Provider\ContactProvider" => array:1 [ …1]
    "Contact\Controller\Plugin\MergeContact" => array:3 [ …3]
    "Contact\Controller\Plugin\ContactActions" => array:3 [ …3]
    "Contact\Controller\Plugin\HandleImport" => array:6 [ …6]
    "Contact\Controller\Plugin\SelectionExport" => array:4 [ …4]
    "Contact\Search\Service\ContactSearchService" => array:1 [ …1]
    "Contact\Search\Service\ProfileSearchService" => array:1 [ …1]
    "Contact\Form\ContactForm" => array:1 [ …1]
    "Contact\Form\View\Helper\ContactFormElement" => array:3 [ …3]
    "Contact\Form\View\Helper\SelectionFormElement" => array:2 [ …2]
    "Contact\Service\AddressService" => array:1 [ …1]
    "Contact\Service\ContactService" => array:9 [ …9]
    "Contact\Service\SelectionContactService" => array:1 [ …1]
    "Contact\Service\SelectionService" => array:3 [ …3]
    "Contact\Service\Office\ContactService" => array:1 [ …1]
    "Quality\Controller\IndexController" => array:1 [ …1]
    "Quality\Controller\ProcessController" => array:2 [ …2]
    "Quality\Controller\PhaseController" => array:2 [ …2]
    "Quality\Controller\StatusController" => array:2 [ …2]
    "Quality\Controller\YearController" => array:2 [ …2]
    "Quality\Controller\ActionController" => array:2 [ …2]
    "Quality\Controller\TargetController" => array:2 [ …2]
    "Quality\Controller\KpiController" => array:2 [ …2]
    "Quality\Controller\Kpi\TargetController" => array:2 [ …2]
    "Quality\Controller\Kpi\GroupController" => array:2 [ …2]
    "Quality\Controller\Kpi\ResultController" => array:2 [ …2]
    "Quality\Controller\Kpi\Result\MatrixController" => array:1 [ …1]
    "Quality\Controller\Kpi\ActionController" => array:1 [ …1]
    "Quality\Controller\Action\SourceController" => array:2 [ …2]
    "Quality\Controller\Action\GroupController" => array:2 [ …2]
    "Quality\Controller\Action\ResultController" => array:2 [ …2]
    "Quality\Controller\Action\Result\MatrixController" => array:2 [ …2]
    "Quality\Service\QualityService" => array:2 [ …2]
    "Quality\View\Helper\Kpi\Result\Matrix" => array:2 [ …2]
    "Quality\View\Helper\Action\Result\Matrix" => array:2 [ …2]
    "Project\Controller\Json\AchievementController" => array:1 [ …1]
    "Project\Controller\Json\Achievement\ExploitableResultController" => array:1 [ …1]
    "Project\Controller\Json\ContractController" => array:3 [ …3]
    "Project\Controller\Json\CostController" => array:5 [ …5]
    "Project\Controller\Json\DescriptionController" => array:1 [ …1]
    "Project\Controller\Json\EffortController" => array:6 [ …6]
    "Project\Controller\Json\FundingController" => array:3 [ …3]
    "Project\Controller\Json\FundingStatusController" => array:2 [ …2]
    "Project\Controller\Json\HelpController" => array:1 [ …1]
    "Project\Controller\Json\IdeaController" => array:1 [ …1]
    "Project\Controller\Json\Idea\ToolController" => array:2 [ …2]
    "Project\Controller\Json\Idea\PosterController" => array:2 [ …2]
    "Project\Controller\Json\InviteController" => array:6 [ …6]
    "Project\Controller\Json\ReportController" => array:1 [ …1]
    "Project\Controller\Json\ResultController" => array:1 [ …1]
    "Project\Controller\Json\WorkpackageController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\TaskController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\DeliverableController" => array:3 [ …3]
    "Project\Controller\Action\TypeController" => array:3 [ …3]
    "Project\Controller\Action\ActionController" => array:10 [ …10]
    "Project\Controller\Event\TypeController" => array:3 [ …3]
    "Project\Controller\SelectionController" => array:4 [ …4]
    "Project\Controller\Event\EventController" => array:5 [ …5]
    "Project\Controller\ChangeRequest\ChangeRequestController" => array:7 [ …7]
    "Project\Controller\ChangeRequest\ProcessController" => array:9 [ …9]
    "Project\Controller\ChangeRequest\UpdateController" => array:14 [ …14]
    "Project\Controller\ChangeRequest\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\Admin\DetailsController" => array:3 [ …3]
    "Project\Controller\Idea\PosterManagerController" => array:5 [ …5]
    "Project\Controller\Idea\PosterController" => array:1 [ …1]
    "Project\Controller\Achievement\AchievementController" => array:6 [ …6]
    "Project\Controller\Achievement\ExploitableResultController" => array:6 [ …6]
    "Project\Controller\Achievement\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\TypeController" => array:2 [ …2]
    "Project\Controller\Achievement\CategoryController" => array:4 [ …4]
    "Project\Controller\Achievement\ExploitableResult\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\ExploitableResult\LinkController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Link\ManagerController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\DocumentController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Document\ManagerController" => array:3 [ …3]
    "Project\Controller\Award\AwardController" => array:3 [ …3]
    "Project\Controller\Award\TypeController" => array:2 [ …2]
    "Project\Controller\Contract\ContractController" => array:6 [ …6]
    "Project\Controller\Contract\DocumentController" => array:1 [ …1]
    "Project\Controller\Contract\VersionController" => array:3 [ …3]
    "Project\Controller\CommunityController" => array:21 [ …21]
    "Project\Controller\Rationale\RationaleController" => array:10 [ …10]
    "Project\Controller\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\DocumentController" => array:5 [ …5]
    "Project\Controller\Document\TypeController" => array:2 [ …2]
    "Project\Controller\EditController" => array:14 [ …14]
    "Project\Controller\FeeManagerController" => array:2 [ …2]
    "Project\Controller\HelpController" => array:3 [ …3]
    "Project\Controller\EventManagerController" => array:4 [ …4]
    "Project\Controller\HelpManagerController" => array:3 [ …3]
    "Project\Controller\ImageController" => array:1 [ …1]
    "Project\Controller\Idea\IdeaController" => array:13 [ …13]
    "Project\Controller\Idea\InviteController" => array:3 [ …3]
    "Project\Controller\Idea\DescriptionController" => array:2 [ …2]
    "Project\Controller\Idea\Description\TypeController" => array:2 [ …2]
    "Project\Controller\Idea\ToolController" => array:1 [ …1]
    "Project\Controller\Idea\ToolManagerController" => array:4 [ …4]
    "Project\Controller\Idea\Tool\Session\ManagerController" => array:5 [ …5]
    "Project\Controller\Idea\Tool\SessionController" => array:2 [ …2]
    "Project\Controller\Idea\PartnerController" => array:3 [ …3]
    "Project\Controller\Idea\DocumentController" => array:2 [ …2]
    "Project\Controller\Idea\ImageController" => array:2 [ …2]
    "Project\Controller\Idea\VideoController" => array:3 [ …3]
    "Project\Controller\Idea\MeetingController" => array:4 [ …4]
    "Project\Controller\Idea\MeetingManagerController" => array:3 [ …3]
    "Project\Controller\Idea\Meeting\InviteController" => array:5 [ …5]
    "Project\Controller\Idea\MessageController" => array:3 [ …3]
    "Project\Controller\Idea\Message\DocumentController" => array:1 [ …1]
    "Project\Controller\Idea\StatusController" => array:3 [ …3]
    "Project\Controller\Idea\Status\DocumentController" => array:1 [ …1]
    "Project\Controller\InviteController" => array:6 [ …6]
    "Project\Controller\PcaController" => array:3 [ …3]
    "Project\Controller\PcaManagerController" => array:5 [ …5]
    "Project\Controller\LogManagerController" => array:5 [ …5]
    "Project\Controller\Project\AdminController" => array:23 [ …23]
    "Project\Controller\Project\CalendarManagerController" => array:3 [ …3]
    "Project\Controller\Project\ProjectController" => array:2 [ …2]
    "Project\Controller\Project\DetailsController" => array:24 [ …24]
    "Project\Controller\Project\ExportController" => array:1 [ …1]
    "Project\Controller\Project\ManagerController" => array:8 [ …8]
    "Project\Controller\Rationale\ManagerController" => array:4 [ …4]
    "Project\Controller\Report\ReportController" => array:6 [ …6]
    "Project\Controller\Report\DetailsController" => array:11 [ …11]
    "Project\Controller\Report\ItemController" => array:3 [ …3]
    "Project\Controller\Report\ManagerController" => array:10 [ …10]
    "Project\Controller\Report\WindowController" => array:3 [ …3]
    "Project\Controller\Report\Window\ProjectController" => array:2 [ …2]
    "Project\Controller\Result\CategoryController" => array:2 [ …2]
    "Project\Controller\Result\ManagerController" => array:6 [ …6]
    "Project\Controller\Result\TypeController" => array:2 [ …2]
    "Project\Controller\RoadmapController" => array:5 [ …5]
    "Project\Controller\Version\VersionController" => array:11 [ …11]
    "Project\Controller\Version\DocumentController" => array:5 [ …5]
    "Project\Controller\Version\Document\ManagerController" => array:6 [ …6]
    "Project\Controller\Version\ManagerController" => array:15 [ …15]
    "Project\Controller\Version\TypeController" => array:3 [ …3]
    "Project\Controller\Workpackage\WorkpackageController" => array:7 [ …7]
    "Project\Controller\Workpackage\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\DocumentManagerController" => array:5 [ …5]
    "Project\Controller\Workpackage\Deliverable\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\Deliverable\DocumentManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\ManagerController" => array:6 [ …6]
    "Project\Controller\Workpackage\Deliverable\TypeController" => array:3 [ …3]
    "Project\Controller\StatisticsController" => array:1 [ …1]
    "Project\Provider\ProjectProvider" => array:6 [ …6]
    "Project\Provider\Version\VersionProvider" => array:3 [ …3]
    "Project\Job\CometChat\CreateIdeaGroup" => array:4 [ …4]
    "Project\Job\CometChat\UpdateMembersOfIdeaGroup" => array:4 [ …4]
    "Project\Controller\Plugin\CreateExport" => array:4 [ …4]
    "Project\Controller\Plugin\SelectionExport" => array:5 [ …5]
    "Project\Controller\Plugin\Merge\CreateMergedDocument" => array:12 [ …12]
    "Project\Controller\Plugin\Merge\CreateSummaryDocument" => array:4 [ …4]
    "Project\Controller\Plugin\Merge\CreateMergedProjectReport" => array:13 [ …13]
    "Project\Controller\Plugin\Merge\CreateMergedChangeRequestDocument" => array:7 [ …7]
    "Project\Controller\Plugin\CreateVersion" => array:7 [ …7]
    "Project\Controller\Plugin\Checklist\ProjectChecklist" => array:8 [ …8]
    "Project\Controller\Plugin\Checklist\ReportChecklist" => array:5 [ …5]
    "Project\Controller\Plugin\Changes\ProjectChanges" => array:5 [ …5]
    "Project\Controller\Plugin\Checklist\ChangeRequestChecklist" => array:7 [ …7]
    "Project\Controller\Plugin\RenderReportWorkpackageDescriptions" => array:2 [ …2]
    "Project\Controller\Plugin\RenderVersionStatistics" => array:7 [ …7]
    "Project\Controller\Plugin\Achievement\Export" => array:2 [ …2]
    "Project\Controller\Plugin\Achievement\Import" => array:2 [ …2]
    "Project\Controller\Plugin\ActionExport" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\IdeasPerCountryDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Invite\Accept" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Accept" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Export" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionPdf" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionSpreadsheet" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Poster\PosterPdf" => array:3 [ …3]
    "Project\InputFilter\RationaleFilter" => array:1 [ …1]
    "Project\Form\ProjectForm" => array:1 [ …1]
    "Project\Service\ProjectService" => array:9 [ …9]
    "Project\Service\ActionService" => array:5 [ …5]
    "Project\Service\VersionService" => array:3 [ …3]
    "Project\Service\WorkpackageService" => array:4 [ …4]
    "Project\Service\IdeaService" => array:12 [ …12]
    "Project\Service\Idea\MeetingService" => array:2 [ …2]
    "Project\Service\Idea\Tool\SessionService" => array:2 [ …2]
    "Project\Service\DescriptionService" => array:3 [ …3]
    "Project\Service\ResultService" => array:4 [ …4]
    "Project\Service\VersionDocumentService" => array:4 [ …4]
    "Project\Service\EventService" => array:2 [ …2]
    "Project\Service\HelpService" => array:2 [ …2]
    "Project\Service\KeywordService" => array:1 [ …1]
    "Project\Service\AchievementService" => array:4 [ …4]
    "Project\Service\Achievement\ExploitableResultService" => array:4 [ …4]
    "Project\Service\ReportService" => array:2 [ …2]
    "Project\Service\DocumentService" => array:1 [ …1]
    "Project\Service\ContractService" => array:2 [ …2]
    "Project\Service\InviteService" => array:6 [ …6]
    "Project\Service\SelectionService" => array:1 [ …1]
    "Project\Service\AwardService" => array:1 [ …1]
    "Project\Service\ChangeRequestService" => array:7 [ …7]
    "Project\Service\Report\WindowService" => array:1 [ …1]
    "Project\Search\Service\AchievementSearchService" => array:1 [ …1]
    "Project\Search\Service\Achievement\ExploitableResultSearchService" => array:1 [ …1]
    "Project\Search\Service\IdeaSearchService" => array:1 [ …1]
    "Project\Search\Service\DescriptionSearchService" => array:1 [ …1]
    "Project\Search\Service\ProjectSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\WorkpackageDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\ResultSearchService" => array:1 [ …1]
    "Project\Search\Service\ActionSearchService" => array:1 [ …1]
    "Project\View\Handler\ProjectHandler" => array:16 [ …16]
    "Project\View\Handler\ResultHandler" => array:8 [ …8]
    "Project\View\Handler\IdeaHandler" => array:11 [ …11]
    "Project\View\Helper\Project\StatusIcon" => array:1 [ …1]
    "Project\View\Helper\Project\ProjectDates" => array:3 [ …3]
    "Project\View\Helper\Description\BuildContent" => array:1 [ …1]
    "Project\View\Helper\Description\BuildNavigation" => array:2 [ …2]
    "Project\View\Helper\Description\BuildTree" => array:2 [ …2]
    "Project\View\Helper\Project\Quickstart" => array:2 [ …2]
    "Project\View\Helper\BuildHelp" => array:3 [ …3]
    "Project\View\Helper\Version\VersionLink" => array:6 [ …6]
    "Project\View\Helper\HelpLink" => array:6 [ …6]
    "Project\View\Helper\Report\ReportHelper" => array:1 [ …1]
    "Project\Form\View\Helper\ProjectFormElement" => array:2 [ …2]
    "Evaluation\Controller\ReportController" => array:4 [ …4]
    "Evaluation\Controller\FeedbackController" => array:4 [ …4]
    "Evaluation\Controller\EvaluationController" => array:10 [ …10]
    "Evaluation\Controller\EvaluationManagerController" => array:4 [ …4]
    "Evaluation\Controller\ReportManagerController" => array:5 [ …5]
    "Evaluation\Controller\Report\CriterionController" => array:4 [ …4]
    "Evaluation\Controller\Report\VersionController" => array:4 [ …4]
    "Evaluation\Controller\Report\WindowController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\CategoryController" => array:2 [ …2]
    "Evaluation\Controller\Report\Criterion\TypeController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\TopicController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\VersionController" => array:3 [ …3]
    "Evaluation\Controller\ReviewerManagerController" => array:5 [ …5]
    "Evaluation\Controller\ReviewScheduleController" => array:5 [ …5]
    "Evaluation\Controller\Reviewer\ContactManagerController" => array:2 [ …2]
    "Evaluation\Controller\JsonController" => array:3 [ …3]
    "Evaluation\Controller\Plugin\CreateEvaluation" => array:5 [ …5]
    "Evaluation\Controller\Plugin\RosterGenerator" => array:3 [ …3]
    "Evaluation\Controller\Plugin\Report\ExcelExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ExcelDownload" => array:2 [ …2]
    "Evaluation\Controller\Plugin\Report\ExcelImport" => array:1 [ …1]
    "Evaluation\Controller\Plugin\Report\PdfExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ConsolidatedPdfExport" => array:10 [ …10]
    "Evaluation\Controller\Plugin\Report\Presentation" => array:2 [ …2]
    "Evaluation\Controller\Plugin\RenderProjectEvaluation" => array:3 [ …3]
    "Evaluation\Service\EvaluationService" => array:1 [ …1]
    "Evaluation\Service\EvaluationReportService" => array:2 [ …2]
    "Evaluation\Service\ReviewerService" => array:1 [ …1]
    "Evaluation\Service\ReviewRosterService" => array:5 [ …5]
    "Evaluation\View\Helper\Report\Progress" => array:2 [ …2]
    "Evaluation\View\Helper\Report\Score" => array:1 [ …1]
    "Press\Controller\ArticleController" => array:5 [ …5]
    "Press\Controller\BureauController" => array:3 [ …3]
    "Press\Controller\PressController" => array:1 [ …1]
    "Press\Service\PressService" => array:2 [ …2]
    "Press\Search\Service\PressSearchService" => array:1 [ …1]
    "Press\View\Handler\PressHandler" => array:7 [ …7]
    "Program\Controller\Plugin\CreateCallFundingOverview" => array:5 [ …5]
    "Program\Controller\Plugin\CreateFundingDownload" => array:3 [ …3]
    "Program\Controller\Plugin\RenderDoa" => array:3 [ …3]
    "Program\Controller\Plugin\RenderNda" => array:3 [ …3]
    "Program\Controller\Plugin\CallSizeSpreadsheet" => array:8 [ …8]
    "Program\Controller\CallController" => array:6 [ …6]
    "Program\Controller\CallCountryManagerController" => array:4 [ …4]
    "Program\Controller\CallManagerController" => array:9 [ …9]
    "Program\Controller\DoaController" => array:4 [ …4]
    "Program\Controller\FunderManagerController" => array:3 [ …3]
    "Program\Controller\NdaController" => array:6 [ …6]
    "Program\Controller\NdaManagerController" => array:8 [ …8]
    "Program\Controller\ProgramManagerController" => array:3 [ …3]
    "Program\Service\ProgramService" => array:5 [ …5]
    "Program\Service\CallService" => array:3 [ …3]
    "Program\View\Handler\ProgramHandler" => array:6 [ …6]
    "Program\View\Helper\CallInformationBox" => array:3 [ …3]
    "Search\Controller\IndexController" => array:1 [ …1]
    "Search\Command\UpdateIndex" => array:1 [ …1]
    "Search\Service\ConsoleService" => array:22 [ …22]
    "Admin\Controller\AccessController" => array:5 [ …5]
    "Admin\Controller\AdminController" => array:9 [ …9]
    "Admin\Controller\QueueController" => array:2 [ …2]
    "Admin\Controller\Api\LogController" => array:1 [ …1]
    "Admin\Controller\UserController" => array:5 [ …5]
    "Admin\Controller\OAuth2Controller" => array:3 [ …3]
    "Admin\Controller\OAuth2\ClientController" => array:3 [ …3]
    "Admin\Controller\OAuth2\ScopeController" => array:2 [ …2]
    "Admin\Controller\StatisticsController" => array:3 [ …3]
    "Admin\Controller\CacheController" => array:1 [ …1]
    "Admin\Controller\FixController" => []
    "Admin\Controller\PermitController" => array:3 [ …3]
    "Admin\InputFilter\AccessFilter" => array:1 [ …1]
    "Admin\Service\AdminService" => array:3 [ …3]
    "Admin\Service\StatisticsService" => array:1 [ …1]
    "Admin\Service\QueueService" => array:1 [ …1]
    "Admin\Service\ApiService" => array:1 [ …1]
    "Admin\Service\OAuth2Service" => array:1 [ …1]
    "Admin\Form\View\Helper\AccessFormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormCheckbox" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterBarElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterColumnElement" => array:2 [ …2]
    "Affiliation\Controller\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\EditController" => array:11 [ …11]
    "Affiliation\Controller\Admin\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\Admin\IndexController" => array:4 [ …4]
    "Affiliation\Controller\Admin\EditController" => array:11 [ …11]
    "Affiliation\Controller\Json\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Json\LoiController" => array:4 [ …4]
    "Affiliation\Controller\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Doa\ManagerController" => array:9 [ …9]
    "Affiliation\Controller\LoiController" => array:5 [ …5]
    "Affiliation\Controller\Loi\ManagerController" => array:7 [ …7]
    "Affiliation\Controller\Questionnaire\CategoryManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireController" => array:4 [ …4]
    "Affiliation\Provider\AffiliationProvider" => array:2 [ …2]
    "Affiliation\Service\AffiliationService" => array:14 [ …14]
    "Affiliation\Service\QuestionnaireService" => array:2 [ …2]
    "Affiliation\Service\DoaService" => array:1 [ …1]
    "Affiliation\Service\LoiService" => array:1 [ …1]
    "Affiliation\Controller\Plugin\RenderPaymentSheet" => array:9 [ …9]
    "Affiliation\Controller\Plugin\RenderLoi" => array:3 [ …3]
    "Affiliation\Controller\Plugin\MergeAffiliation" => array:2 [ …2]
    "Affiliation\View\Helper\PaymentSheet" => array:8 [ …8]
    "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper" => array:1 [ …1]
    "Organisation\Controller\JsonController" => array:3 [ …3]
    "Organisation\Controller\Organisation\NoteController" => array:3 [ …3]
    "Organisation\Controller\ImageController" => array:3 [ …3]
    "Organisation\Controller\BoardController" => array:3 [ …3]
    "Organisation\Controller\Organisation\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Organisation\FinancialController" => array:4 [ …4]
    "Organisation\Controller\Organisation\ListController" => array:2 [ …2]
    "Organisation\Controller\Organisation\ManagerController" => array:7 [ …7]
    "Organisation\Controller\Organisation\TypeController" => array:3 [ …3]
    "Organisation\Controller\AdvisoryBoard\City\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\City\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\AdvisoryBoard\Solution\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\Solution\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\SelectionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ContributionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ManagerController" => array:5 [ …5]
    "Organisation\Controller\Parent\ListController" => array:5 [ …5]
    "Organisation\Controller\Parent\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Parent\OrganisationController" => array:6 [ …6]
    "Organisation\Controller\Parent\TypeController" => array:3 [ …3]
    "Organisation\Controller\Parent\DoaController" => array:6 [ …6]
    "Organisation\Controller\Parent\FinancialController" => array:6 [ …6]
    "Organisation\Controller\UpdateController" => array:4 [ …4]
    "Organisation\Controller\Update\ManagerController" => array:5 [ …5]
    "Organisation\Command\Cleanup" => array:1 [ …1]
    "Organisation\Search\Service\OrganisationSearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => array:1 [ …1]
    "Organisation\View\Handler\OrganisationHandler" => array:9 [ …9]
    "Organisation\View\Handler\AdvisoryBoard\CityHandler" => array:7 [ …7]
    "Organisation\View\Handler\AdvisoryBoard\SolutionHandler" => array:7 [ …7]
    "Organisation\Controller\Plugin\HandleParentAndProjectImport" => array:8 [ …8]
    "Organisation\Controller\Plugin\RenderOverviewExtraVariableContributionSheet" => array:7 [ …7]
    "Organisation\Controller\Plugin\RenderOverviewVariableContributionSheet" => array:8 [ …8]
    "Organisation\Controller\Plugin\Merge\OrganisationMerge" => array:4 [ …4]
    "Organisation\Controller\Plugin\Merge\ParentOrganisationMerge" => array:2 [ …2]
    "Organisation\Controller\Plugin\SelectionExport" => array:2 [ …2]
    "Organisation\Form\OrganisationForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\CityForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\SolutionForm" => array:1 [ …1]
    "Organisation\Form\UpdateForm" => array:1 [ …1]
    "Organisation\Form\FinancialForm" => array:1 [ …1]
    "Organisation\Form\View\Helper\OrganisationFormElement" => array:3 [ …3]
    "Organisation\Form\View\Helper\ParentFormElement" => array:2 [ …2]
    "Organisation\View\Helper\UpdateNotification" => array:2 [ …2]
    "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution" => array:7 [ …7]
    "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution" => array:7 [ …7]
    "Organisation\Service\AdvisoryBoard\CityService" => array:3 [ …3]
    "Organisation\Service\AdvisoryBoard\SolutionService" => array:3 [ …3]
    "Organisation\Service\BoardService" => array:1 [ …1]
    "Organisation\Service\SelectionService" => array:1 [ …1]
    "Organisation\Service\UpdateService" => array:3 [ …3]
    "Publication\Acl\Assertion\Publication" => array:4 [ …4]
    "Publication\Controller\CategoryController" => array:3 [ …3]
    "Publication\Controller\CommunityController" => array:1 [ …1]
    "Publication\Controller\PublicationController" => array:1 [ …1]
    "Publication\Controller\PublicationManagerController" => array:5 [ …5]
    "Publication\Controller\TypeController" => array:4 [ …4]
    "Publication\Search\Service\PublicationSearchService" => array:1 [ …1]
    "Publication\Service\PublicationService" => array:3 [ …3]
    "Invoice\Controller\ConsoleController" => array:1 [ …1]
    "Invoice\Controller\DimensionController" => array:3 [ …3]
    "Invoice\Controller\ExportController" => array:2 [ …2]
    "Invoice\Controller\ForecastController" => array:3 [ …3]
    "Invoice\Controller\InvoiceController" => array:17 [ …17]
    "Invoice\Controller\InvoiceCreateController" => array:15 [ …15]
    "Invoice\Controller\JournalController" => array:1 [ …1]
    "Invoice\Controller\PdfController" => array:1 [ …1]
    "Invoice\Controller\ReminderController" => array:7 [ …7]
    "Invoice\Controller\RowController" => array:4 [ …4]
    "Invoice\Controller\TransactionController" => array:2 [ …2]
    "Invoice\Controller\WordController" => array:1 [ …1]
    "Invoice\Command\DailyUpdate" => array:4 [ …4]
    "Invoice\Command\Sync" => array:1 [ …1]
    "Invoice\Controller\Plugin\CreateCreditInvoice" => array:2 [ …2]
    "Invoice\Controller\Plugin\CreateIncomeForecast" => array:6 [ …6]
    "Invoice\Controller\Plugin\InvoiceExport" => array:3 [ …3]
    "Invoice\Controller\Plugin\InvoiceExportUbl" => array:4 [ …4]
    "Invoice\Controller\Plugin\RenderInvoice" => array:8 [ …8]
    "Invoice\Controller\Plugin\RenderReminder" => array:5 [ …5]
    "Invoice\Controller\Plugin\CreateInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentInvoice" => array:4 [ …4]
    "Invoice\Controller\Plugin\CreateWordInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentExtraInvoice" => array:4 [ …4]
    "Invoice\Service\InvoiceService" => array:9 [ …9]
    "Invoice\Service\TransactionService" => array:3 [ …3]
    "Invoice\Search\Service\InvoiceSearchService" => array:1 [ …1]
    "Invoice\View\Helper\DailyUpdateHandler" => array:2 [ …2]
    "Deeplink\Controller\DeeplinkController" => array:5 [ …5]
    "Deeplink\Controller\TargetController" => array:4 [ …4]
    "Deeplink\InputFilter\TargetFilter" => array:2 [ …2]
    "Deeplink\Service\DeeplinkService" => array:2 [ …2]
    "Deeplink\View\Helper\CanAssemble" => array:1 [ …1]
    "Event\Controller\BadgeImageManagerController" => array:9 [ …9]
    "Event\Controller\BadgeManagerController" => array:13 [ …13]
    "Event\Controller\BoothController" => array:10 [ …10]
    "Event\Controller\BoothManagerController" => array:9 [ …9]
    "Event\Controller\BoothSpecManagerController" => array:4 [ …4]
    "Event\Controller\DeskCostsController" => array:2 [ …2]
    "Event\Controller\ExhibitionCostController" => array:3 [ …3]
    "Event\Controller\ExhibitionSpecManagerController" => array:3 [ …3]
    "Event\Controller\ExhibitionManagerController" => array:5 [ …5]
    "Event\Controller\ExportController" => array:1 [ …1]
    "Event\Controller\JsonController" => array:4 [ …4]
    "Event\Controller\Meeting\AdminController" => array:4 [ …4]
    "Event\Controller\Meeting\MeetingController" => array:9 [ …9]
    "Event\Controller\Meeting\CostController" => array:2 [ …2]
    "Event\Controller\Meeting\QuotaController" => array:4 [ …4]
    "Event\Controller\Meeting\CouponController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionCostController" => array:2 [ …2]
    "Event\Controller\Meeting\FloorplanController" => array:5 [ …5]
    "Event\Controller\Meeting\ManagerController" => array:14 [ …14]
    "Event\Controller\RegistrationController" => array:9 [ …9]
    "Event\Controller\PaymentController" => array:3 [ …3]
    "Event\Controller\RegistrationManagerController" => array:7 [ …7]
    "Event\Controller\TicketManagerController" => array:11 [ …11]
    "Event\Job\CometChat\CreateUser" => array:3 [ …3]
    "Event\Job\CometChat\CreateAuthToken" => array:3 [ …3]
    "Event\Job\CometChat\DeleteUser" => array:3 [ …3]
    "Event\Command\CancelPaymentPending" => array:1 [ …1]
    "Event\Command\UpdateRegistrations" => array:1 [ …1]
    "Event\Controller\Plugin\BoothExport" => array:3 [ …3]
    "Event\Controller\Plugin\RegistrationExport" => array:1 [ …1]
    "Event\Controller\Plugin\RenderReceipt" => array:4 [ …4]
    "Event\Controller\Plugin\MeetingFacebook" => array:4 [ …4]
    "Event\Controller\Plugin\BadgePdf" => array:5 [ …5]
    "Event\Controller\Plugin\TicketPdf" => array:4 [ …4]
    "Event\View\Handler\MeetingHandler" => array:8 [ …8]
    "Event\View\Helper\RegistrationLink" => array:6 [ …6]
    "Event\Search\Service\RegistrationSearchService" => array:1 [ …1]
    "Event\Service\BadgeService" => array:1 [ …1]
    "Event\Service\MeetingService" => array:4 [ …4]
    "Event\Service\ExhibitionService" => array:1 [ …1]
    "Event\Service\BoothService" => array:3 [ …3]
    "Event\Service\RegistrationService" => array:16 [ …16]
    "Event\Service\ExhibitionFloorplanService" => array:1 [ …1]
    "Event\Service\ExhibitionSpecService" => array:1 [ …1]
    "Calendar\Controller\CalendarController" => array:2 [ …2]
    "Calendar\Controller\TypeController" => array:2 [ …2]
    "Calendar\Controller\CommunityController" => array:11 [ …11]
    "Calendar\Controller\DocumentController" => array:4 [ …4]
    "Calendar\Controller\JsonController" => array:1 [ …1]
    "Calendar\Controller\ManagerController" => array:10 [ …10]
    "Calendar\Controller\Plugin\RenderCalendarContactList" => array:3 [ …3]
    "Calendar\Controller\Plugin\RenderReviewCalendar" => array:2 [ …2]
    "Calendar\Service\CalendarService" => array:7 [ …7]
    "Calendar\Search\Service\CalendarSearchService" => array:1 [ …1]
    "Calendar\View\Handler\CalendarHandler" => array:7 [ …7]
    "Mailing\Command\FlushQueue" => array:1 [ …1]
    "Mailing\Command\SendQueue" => array:1 [ …1]
    "Mailing\Controller\AttachmentController" => array:2 [ …2]
    "Mailing\Controller\ConsoleController" => array:1 [ …1]
    "Mailing\Controller\MailingContactController" => array:1 [ …1]
    "Mailing\Controller\MailingManagerController" => array:6 [ …6]
    "Mailing\Controller\JsonController" => array:3 [ …3]
    "Mailing\Controller\MailingSubscriptionController" => array:6 [ …6]
    "Mailing\Controller\SenderManagerController" => array:3 [ …3]
    "Mailing\Controller\TemplateManagerController" => array:3 [ …3]
    "Mailing\InputFilter\MailingFilter" => array:1 [ …1]
    "Mailing\InputFilter\SenderFilter" => array:1 [ …1]
    "Mailing\InputFilter\TemplateFilter" => array:1 [ …1]
    "Mailing\Service\MailingService" => array:4 [ …4]
    "Accounting\Controller\TwinfieldController" => array:2 [ …2]
    "Accounting\Adapter\TwinfieldAdapter" => array:3 [ …3]
  ]
  "lmc_cors" => array:3 [
    "allowed_origins" => array:1 [ …1]
    "allowed_methods" => array:5 [ …5]
    "allowed_headers" => array:3 [ …3]
  ]
  "console" => array:1 [
    "router" => array:1 [ …1]
  ]
  "zfctwig" => array:9 [
    "environment_loader" => "ZfcTwigLoaderChain"
    "environment_class" => "Twig\Environment"
    "environment_options" => array:2 [ …2]
    "loader_chain" => array:3 [ …3]
    "extensions" => array:14 [ …14]
    "suffix" => "twig"
    "enable_fallback_functions" => true
    "disable_zf_model" => false
    "helper_manager" => array:1 [ …1]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [ …6]
    "toolbar" => array:5 [ …5]
    "events" => array:3 [ …3]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:7 [ …7]
    "factories" => array:7 [ …7]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [ …1]
  ]
  "translator" => array:3 [
    "locale" => "en_GB"
    "cache" => true
    "translation_file_patterns" => array:1 [ …1]
  ]
  "web" => array:5 [
    "title" => "ITEA 4"
    "description" => "ITEA is the Eureka R&D&I Cluster programme for software innovation, enabling a large international community to collaborate in funded projects that turn innovative ideas into new businesses, jobs, economic growth and benefits for society."
    "keywords" => "Software-intensive Systems & Services, EUREKA Cluster, R&D, R&D projects, Innovation, Business Impact, Seizing the high ground, Fast Exploitation, Happiness"
    "author" => "Johan van der Heide, johan.van.der.heide[at]itea4.org"
    "site_name" => "itea4.org"
  ]
  "authenticate" => array:1 [
    "useAdditionalEmailAddresses" => true
  ]
  "session_config" => array:3 [
    "cache_expire" => 86400
    "cookie_lifetime" => 86400
    "name" => "itea"
  ]
  "navigation" => array:6 [
    "default" => []
    "project-community" => []
    "community" => array:6 [ …6]
    "admin" => array:14 [ …14]
    "community2" => array:1 [ …1]
    "call" => array:6 [ …6]
  ]
  "content_option" => array:3 [
    "vimeoClientId" => "08fdab5ca150505195e18a91774f67a6bae59cd3"
    "vimeoClientSecret" => "5Dc8mhmhiByGpBp7XFoY7+6rTi5NXGu+OWuU4E97JELWz3oNryFAP0GsbC/h9tvY4KA3dTORoQ31dIk5AGx1HRwjR5t2uXTpZEHMSkWdnjqKi3GFs7acWyzg6mIGEfdV"
    "vimeoAccessToken" => "947086738c8843c59ea7755d410c2288"
  ]
  "general_option" => array:5 [
    "serverUrl" => "https://dev1.itea4.org"
    "thumborServer" => "https://image.itea3.org"
    "thumborSecret" => "mKiWlumnpbX1YWpW6lbm"
    "assets" => "/var/www/dev1/config/itea/../../styles/itea/img"
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "cluster_options" => array:2 [
    "reporting_portal_api_url" => "https://api.eurekaclusters.eu"
    "bearer_token" => "abcd"
  ]
  "slm_queue" => array:6 [
    "job_manager" => array:1 [ …1]
    "queues" => array:1 [ …1]
    "worker_strategies" => array:2 [ …2]
    "strategy_manager" => array:2 [ …2]
    "queue_manager" => array:1 [ …1]
    "worker_manager" => []
  ]
  "project_option" => array:9 [
    "rationale_require_contact_with_funder" => false
    "evaluation_project_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "evaluation_report_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "evaluation_presentation_templates" => array:2 [ …2]
    "evaluation_report_author" => "Itea Office"
    "project_summary_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/project-summary.docx"
    "change_request_document_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/cr-document.docx"
    "header_logo" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/footer.png"
  ]
  "evaluation_options" => array:4 [
    "projectTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "reportTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "presentationTemplates" => array:2 [ …2]
    "reportAuthor" => "ITEA Office"
  ]
  "program_option" => array:6 [
    "nda_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "doa_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "blank_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "has_nda" => true
    "header_logo" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/footer.png"
  ]
  "google" => array:1 [
    "cx" => "009339216969913709813:g_lfsuqxjz0"
  ]
  "solr" => array:2 [
    "host" => "app2"
    "connection" => array:23 [ …23]
  ]
  "admin_option" => array:1 [
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "affiliation_option" => array:3 [
    "doa_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/doa-template.pdf"
    "loi_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/nda-template.pdf"
    "payment_sheet_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "organisation_option" => array:2 [
    "overview_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
    "overview_extra_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
  ]
  "invoice_option" => array:11 [
    "mollie_api_key" => "live_lsaXAz3GAweHE1zzTr15WPt5FEZFeB"
    "payment_days" => 30
    "complaint_days" => 14
    "contract_data_start_year" => 2018
    "invoice_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/pdf/invoice-template.pdf"
    "variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/variable-fee-template.docx"
    "extra_variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/extra-variable-fee-template.docx"
    "invoice_mask" => "YYYY####"
    "local_country" => "NLD"
    "bcc_email_address" => "finance@itea4.org"
    "from_email_address" => "finance@itea4.org"
  ]
  "event_option" => array:1 [
    "receipt_template" => "/var/www/dev1/module/event/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "calendar_option" => array:2 [
    "calendar_contact_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "review_calendar_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/review-calendar-template.pdf"
  ]
  "google_analytics" => array:7 [
    "enable" => true
    "id" => ""
    "domain_name" => ""
    "allow_linker" => false
    "enable_display_advertising" => false
    "anonymize_ip" => false
    "script" => "google-analytics-ga"
  ]
  "accounting_options" => array:5 [
    "clientId" => ""
    "clientSecret" => ""
    "refreshToken" => ""
    "redirectURL" => ""
    "office" => ""
  ]
  "listeners" => array:1 [
    0 => "ErrorHeroModule\Listener\Mvc"
  ]
  "email" => array:3 [
    "general" => array:2 [ …2]
    "smtp" => array:5 [ …5]
    "mailjet" => array:2 [ …2]
  ]
  "log" => array:1 [
    "ErrorHeroModuleLogger" => array:1 [ …1]
  ]
  "error-hero-module" => array:5 [
    "enable" => true
    "enable-error-preview-page" => true
    "display-settings" => array:6 [ …6]
    "logging-settings" => array:1 [ …1]
    "email-notification-settings" => array:5 [ …5]
  ]
  "jield_authorize" => array:6 [
    "default_role" => "public"
    "authenticated_role" => "user"
    "access_service" => "Admin\Service\AdminService"
    "permit_service" => "Contact\Service\ContactService"
    "cache_enabled" => true
    "role_entity_class" => "Admin\Entity\Access"
  ]
  "circlical" => array:1 [
    "recaptcha" => array:3 [ …3]
  ]
  "accounting" => array:2 [
    "adapter" => "Accounting\Adapter\Twinfield"
    "options" => array:7 [ …7]
  ]
  "cache" => array:1 [
    "adapter" => array:2 [ …2]
  ]
  "cometchat" => array:5 [
    "app_id" => "190005357f8fde86"
    "region" => "eu"
    "version" => 2
    "auth_key" => "f333a70ecae8f9362a869d8a5753dea3156109c8"
    "api_key" => "344ac4fb44725064a40306c597afac4ba3430f81"
  ]
  "zfr_cors" => array:1 [
    "allowed_origins" => array:3 [ …3]
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
^ array:3 [
  "modules" => array:63 [
    0 => "Laminas\Cache"
    1 => "Laminas\Router"
    2 => "Laminas\Form"
    3 => "Laminas\Navigation"
    4 => "Laminas\Filter"
    5 => "Laminas\Hydrator"
    6 => "Laminas\InputFilter"
    7 => "Laminas\Paginator"
    8 => "Laminas\Router"
    9 => "Laminas\Log"
    10 => "Laminas\Validator"
    11 => "Laminas\Mvc\Plugin\FlashMessenger"
    12 => "Laminas\Mvc\Plugin\Identity"
    13 => "Laminas\ApiTools"
    14 => "Laminas\ApiTools\Documentation"
    15 => "Laminas\ApiTools\Documentation\Swagger"
    16 => "Laminas\ApiTools\ApiProblem"
    17 => "Laminas\ApiTools\Configuration"
    18 => "Laminas\ApiTools\OAuth2"
    19 => "Laminas\ApiTools\MvcAuth"
    20 => "Laminas\ApiTools\Hal"
    21 => "Laminas\ApiTools\ContentNegotiation"
    22 => "Laminas\ApiTools\ContentValidation"
    23 => "Laminas\ApiTools\Rest"
    24 => "Laminas\ApiTools\Rpc"
    25 => "Laminas\ApiTools\Versioning"
    26 => "Api"
    27 => "LmcCors"
    28 => "AssetManager"
    29 => "ZfcTwig"
    30 => "BjyAuthorize"
    31 => "Jield\Authorize"
    32 => "DoctrineModule"
    33 => "DoctrineORMModule"
    34 => "Application"
    35 => "Content"
    36 => "General"
    37 => "Cluster"
    38 => "News"
    39 => "Contact"
    40 => "Quality"
    41 => "Project"
    42 => "Evaluation"
    43 => "Press"
    44 => "Program"
    45 => "Search"
    46 => "Admin"
    47 => "LaminasBootstrap5"
    48 => "Affiliation"
    49 => "Organisation"
    50 => "Publication"
    51 => "Invoice"
    52 => "Deeplink"
    53 => "Event"
    54 => "Calendar"
    55 => "Mailing"
    56 => "LaminasGoogleAnalytics"
    57 => "Accounting"
    58 => "ErrorHeroModule"
    59 => "CirclicalRecaptcha"
    60 => "SlmQueue"
    61 => "SlmQueueDoctrine"
    62 => "Laminas\DeveloperTools"
  ]
  "module_listener_options" => array:7 [
    "config_glob_paths" => array:2 [
      0 => "config/autoload/{,*.}{global,local}.php"
      1 => "config/itea/{,*.}{global,local}.php"
    ]
    "config_cache_enabled" => false
    "cache_dir" => "/var/www/dev1/config/../data/cache"
    "config_cache_key" => "itea"
    "module_map_cache_enabled" => true
    "module_map_cache_key" => "50b41c6263a4a7e8e9298092a44a713d"
    "module_paths" => array:2 [
      0 => "./module"
      1 => "./vendor"
    ]
  ]
  "service_manager" => array:2 [
    "use_defaults" => true
    "factories" => []
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
BjyAuthorize Current Identity Roles public
BjyAuthorize
Identity Roles - 1 role

public
Doctrine ORM (Queries) 93 queries in 110.73 ms
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.session_id AS session_id_1, t0.session_key AS session_key_2, t0.session_name AS session_name_3, t0.ip AS ip_4, t0.date_start AS date_start_5, t0.date_end AS date_end_6, t0.modified AS modified_7, t0.lifetime AS lifetime_8, t0.hits AS hits_9, t0.data AS data_10, t0.contact_id AS contact_id_11 FROM session t0 WHERE t0.session_key = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'sgva6sksidl89e5eludblu3v38' (length=26)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.001600980758667
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '11' (length=2)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00080680847167969
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071096420288086
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00085306167602539
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00092101097106934
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060701370239258
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00065708160400391
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00063014030456543
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00052905082702637
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00049901008605957
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054216384887695
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container' (length=17)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00059294700622559
SQL SELECT t0.content_id AS content_id_1, t0.sequence AS sequence_2, t0.handler_id AS handler_id_3, t0.segment_id AS segment_id_4, t0.node_id AS node_id_5 FROM content t0 WHERE t0.node_id = ? ORDER BY t0.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1426
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00076198577880859
SQL SELECT t0.segment_id AS segment_id_1, t0.segment AS segment_2 FROM content_segment t0 WHERE t0.segment_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064206123352051
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064706802368164
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 714
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063896179199219
SQL SELECT t0.challenge_id AS challenge_id_1, t0.challenge AS challenge_2, t0.docref AS docref_3, t0.prefix AS prefix_4, t0.sequence AS sequence_5, t0.html AS html_6, t0.css AS css_7, t0.sources AS sources_8, t0.abstract AS abstract_9, t0.background_image AS background_image_10, t0.backcolor AS backcolor_11, t0.frontcolor AS frontcolor_12, t0.type_id AS type_id_13, t14.image_id AS image_id_15, t14.image AS image_16, t14.date_updated AS date_updated_17, t14.contenttype_id AS contenttype_id_18, t14.challenge_id AS challenge_id_19, t20.icon_id AS icon_id_21, t20.icon AS icon_22, t20.date_updated AS date_updated_23, t20.contenttype_id AS contenttype_id_24, t20.challenge_id AS challenge_id_25, t26.image_id AS image_id_27, t26.image AS image_28, t26.date_updated AS date_updated_29, t26.contenttype_id AS contenttype_id_30, t26.challenge_id AS challenge_id_31, t32.icon_id AS icon_id_33, t32.icon AS icon_34, t32.date_updated AS date_updated_35, t32.contenttype_id AS contenttype_id_36, t32.challenge_id AS challenge_id_37, t38.pdf_id AS pdf_id_39, t38.pdf AS pdf_40, t38.date_created AS date_created_41, t38.date_end AS date_end_42, t38.challenge_id AS challenge_id_43 FROM challenge t0 LEFT JOIN challenge_image t14 ON t14.challenge_id = t0.challenge_id LEFT JOIN challenge_icon t20 ON t20.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_image t26 ON t26.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_icon t32 ON t32.challenge_id = t0.challenge_id LEFT JOIN challenge_pdf t38 ON t38.challenge_id = t0.challenge_id WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'smart-cities' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.02512001991272
SQL SELECT DISTINCT p0_.project_id AS project_id_0, p0_.project_nr AS project_nr_1, p0_.project AS project_2, p0_.docref AS docref_3, p0_.title AS title_4, p0_.date_start AS date_start_5, p0_.date_pca_signed AS date_pca_signed_6, p0_.date_end AS date_end_7, p0_.date_start_actual AS date_start_actual_8, p0_.date_end_actual AS date_end_actual_9, p0_.date_start_expected AS date_start_expected_10, p0_.date_created AS date_created_11, p0_.description AS description_12, p0_.summary AS summary_13, p0_.html AS html_14, p0_.programcall_id AS programcall_id_15, p0_.contact_id AS contact_id_16 FROM project p0_ WHERE (p0_.project_id IN (SELECT p1_.project_id FROM project_version p2_ INNER JOIN project p1_ ON p2_.project_id = p1_.project_id WHERE p2_.approved = ? AND p2_.type_id = ?)) AND (p0_.project_id NOT IN (SELECT p3_.project_id FROM project_version p4_ INNER JOIN project p3_ ON p4_.project_id = p3_.project_id WHERE p4_.type_id = ? AND p4_.date_submitted IS NOT NULL AND p4_.approved = ? ORDER BY p4_.date_submitted ASC)) AND (p0_.project_id NOT IN (SELECT p5_.project_id FROM project_version p6_ INNER JOIN project p5_ ON p6_.project_id = p5_.project_id WHERE p6_.date_submitted IS NOT NULL AND p6_.date_cancelled IS NOT NULL AND p6_.approved = ? ORDER BY p6_.date_submitted ASC)) AND p0_.project_id IN (SELECT p7_.project_id FROM project_challenge p8_ INNER JOIN project p7_ ON p8_.project_id = p7_.project_id WHERE p8_.challenge_id = ?) ORDER BY p0_.programcall_id DESC, p0_.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
    2 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
    3 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
    4 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
    5 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    2 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    3 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    4 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    5 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0084431171417236
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10807
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010309219360352
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 27
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00093412399291992
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10807
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078797340393066
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8803
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00070691108703613
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061511993408203
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10803
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082516670227051
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10803
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061798095703125
SQL SELECT t0.type_id AS type_id_1, t0.type AS type_2 FROM project_award_type t0 WHERE t0.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061988830566406
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8614
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00050687789916992
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10503
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053596496582031
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006568431854248
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10503
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061798095703125
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10530
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056815147399902
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10530
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061583518981934
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6060
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057196617126465
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10430
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063920021057129
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 20
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00066804885864258
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10430
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005500316619873
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4809
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005030632019043
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10437
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053596496582031
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10437
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00055408477783203
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5098
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053501129150391
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10318
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053215026855469
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 18
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00069093704223633
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10318
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063896179199219
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4385
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056815147399902
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10329
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056314468383789
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10329
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064206123352051
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4499
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00055289268493652
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10334
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005650520324707
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10334
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056099891662598
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4543
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005490779876709
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10211
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.000579833984375
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 16
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00068402290344238
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10211
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054407119750977
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4371
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00047397613525391
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10218
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057697296142578
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10218
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064802169799805
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4447
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00051116943359375
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10206
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005490779876709
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10206
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005500316619873
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4464
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057291984558105
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10224
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058388710021973
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10224
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006251335144043
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4585
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056791305541992
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10156
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064301490783691
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 15
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00084114074707031
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10156
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064611434936523
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4567
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061798095703125
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10080
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0062589645385742
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 13
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078105926513672
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10080
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00059294700622559
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10032
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00052905082702637
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 12
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00066518783569336
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10032
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056791305541992
SQL SELECT t0.type_id AS type_id_1, t0.type AS type_2 FROM project_award_type t0 WHERE t0.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00050997734069824
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 3180
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00050115585327148
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054097175598145
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1131
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057387351989746
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065708160400391
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1131
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056195259094238
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4511
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005340576171875
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.`type` AS type_3, t0.project_id AS project_id_4 FROM project_image t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1137
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00056195259094238
SQL SELECT t0.award_id AS award_id_1, t0.date_created AS date_created_2, t0.date_updated AS date_updated_3, t0.year AS year_4, t0.position AS position_5, t0.sub_type AS sub_type_6, t0.motivation AS motivation_7, t0.project_id AS project_id_8, t0.type_id AS type_id_9 FROM project_award t0 WHERE t0.project_id = ? ORDER BY t0.year DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1137
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053787231445312
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '11' (length=2)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.0006098747253418
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.topic_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 48
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00051999092102051
SQL SELECT t0.challenge_id AS challenge_id_1, t0.challenge AS challenge_2, t0.docref AS docref_3, t0.prefix AS prefix_4, t0.sequence AS sequence_5, t0.html AS html_6, t0.css AS css_7, t0.sources AS sources_8, t0.abstract AS abstract_9, t0.background_image AS background_image_10, t0.backcolor AS backcolor_11, t0.frontcolor AS frontcolor_12, t0.type_id AS type_id_13, t14.image_id AS image_id_15, t14.image AS image_16, t14.date_updated AS date_updated_17, t14.contenttype_id AS contenttype_id_18, t14.challenge_id AS challenge_id_19, t20.icon_id AS icon_id_21, t20.icon AS icon_22, t20.date_updated AS date_updated_23, t20.contenttype_id AS contenttype_id_24, t20.challenge_id AS challenge_id_25, t26.image_id AS image_id_27, t26.image AS image_28, t26.date_updated AS date_updated_29, t26.contenttype_id AS contenttype_id_30, t26.challenge_id AS challenge_id_31, t32.icon_id AS icon_id_33, t32.icon AS icon_34, t32.date_updated AS date_updated_35, t32.contenttype_id AS contenttype_id_36, t32.challenge_id AS challenge_id_37, t38.pdf_id AS pdf_id_39, t38.pdf AS pdf_40, t38.date_created AS date_created_41, t38.date_end AS date_end_42, t38.challenge_id AS challenge_id_43 FROM challenge t0 LEFT JOIN challenge_image t14 ON t14.challenge_id = t0.challenge_id LEFT JOIN challenge_icon t20 ON t20.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_image t26 ON t26.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_icon t32 ON t32.challenge_id = t0.challenge_id LEFT JOIN challenge_pdf t38 ON t38.challenge_id = t0.challenge_id WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'smart-cities' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.014394044876099
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1477
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00095582008361816
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1477
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082802772521973
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1504
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006251335144043
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1504
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060200691223145
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057506561279297
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061392784118652
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1587
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057888031005859
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1587
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00057506561279297
Doctrine ORM (Mappings) 389 mappings
DoctrineORMModule Mappings for doctrine.mapping_collector.orm_default