ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 page header cobalt dots

Exploitable Results of ITEA projects

Here you can find the Exploitable Results by Third Parties (ERTP) documents of the finished ITEA projects. This is a concise technical description of the project’s outputs that can be reused by new projects, or more generally third parties (under conditions). These results may be technologies or integrated products, sub-systems, components, software libraries (closed or open-source), standards, algorithms, etc.

Title Download Project name Publication date
ITEA OPTIMUM Exploitable Results by Third Parties.pdf
(ITEA 3) 27 May 2021
ITEA BIMy Exploitable Results by Third Parties.pdf
(ITEA 3) 15 Mar 2021
ITEA EMPHYSIS Exploitable Results by Third Parties.pdf
(ITEA 3) 03 Feb 2021
ITEA COMPACT Exploitable Results by Third Parties.pdf
(ITEA 3) 14 Jan 2021
ITEA HI-RISE Exploitable Results by Third Parties.pdf
(ITEA 3) 08 Dec 2020
ITEA SecureGrid Exploitable Results by Third Parties.pdf
(ITEA 3) 02 Dec 2020
ITEA PARFAIT Exploitable Results by Third Parties.pdf
(ITEA 3) 30 Nov 2020
ITEA PARTNER Exploitable Results by Third Parties.pdf
(ITEA 3) 12 Nov 2020
ITEA PAPUD Exploitable Results by Third Parties.pdf
(ITEA 3) 05 Nov 2020
ITEA VMAP Exploitable Results by Third Parties.pdf
(ITEA 3) 19 Oct 2020
ITEA SOLOMON Exploitable Results by Third Parties.pdf
(ITEA 3) 12 Oct 2020
ITEA SOLOMON Exploitable Results by Third Parties.pdf
(ITEA 3) 07 Oct 2020
ITEA STARLIT Exploitable Results by Third Parties.pdf
(ITEA 3) 16 Sep 2020
ITEA TESTOMAT Project Exploitable Results by Third Parties.pdf
(ITEA 3) 15 Sep 2020
ITEA SPEAR Exploitable Results by Third Parties.pdf
(ITEA 3) 15 Sep 2020
ITEA eWatch Exploitable Results by Third Parties.pdf
(ITEA 3) 14 Apr 2020
ITEA Safe Rescue Exploitable Results by Third Parties.pdf
(ITEA 3) 12 Mar 2020
ITEA PS-CRIMSON Exploitable Results by Third Parties.pdf
(ITEA 3) 03 Feb 2020
ITEA REVaMP2 Exploitable Results by Third Parties.pdf
(ITEA 3) 16 Dec 2019
ITEA APPSTACLE Exploitable Results by Third Parties.pdf
(ITEA 3) 12 Dec 2019
ITEA ESTABLISH Exploitable Results by Third Parties.pdf
(ITEA 3) 03 Dec 2019
ITEA CitiSim Exploitable Results by Third Parties.pdf
(ITEA 3) 26 Nov 2019
ITEA Panacea Gaming Platform Exploitable Results by Third Parties.pdf
(ITEA 3) 09 Oct 2019
ITEA MOS2S Exploitable Results by Third Parties.pdf
(ITEA 3) 05 Sep 2019
ITEA ENTOC Exploitable Results by Third Parties.pdf
(ITEA 3) 01 Jul 2019
77 results on 4 pages

Laminas
Documentation Modules Gallery PHP Version 8.0.14 Extensions intl ModulesLaminas\CacheLaminas\RouterLaminas\FormLaminas\NavigationLaminas\FilterLaminas\HydratorLaminas\InputFilterLaminas\PaginatorLaminas\LogLaminas\ValidatorLaminas\Mvc\Plugin\FlashMessengerLaminas\Mvc\Plugin\IdentityLaminas\ApiToolsLaminas\ApiTools\DocumentationLaminas\ApiTools\Documentation\SwaggerLaminas\ApiTools\ApiProblemLaminas\ApiTools\ConfigurationLaminas\ApiTools\OAuth2Laminas\ApiTools\MvcAuthLaminas\ApiTools\HalLaminas\ApiTools\ContentNegotiationLaminas\ApiTools\ContentValidationLaminas\ApiTools\RestLaminas\ApiTools\RpcLaminas\ApiTools\VersioningApiLmcCorsAssetManagerZfcTwigBjyAuthorizeJield\AuthorizeDoctrineModuleDoctrineORMModuleApplicationContentGeneralClusterNewsContactQualityProjectEvaluationPressProgramSearchAdminLaminasBootstrap5AffiliationOrganisationPublicationInvoiceDeeplinkEventCalendarMailingLaminasGoogleAnalyticsAccountingErrorHeroModuleCirclicalRecaptchaSlmQueueSlmQueueDoctrineLaminas\DeveloperTools
Request and Response 200 NodeController::node on content-route-1
Status code 200 Method GET Controller Content\Controller\NodeController Action node Other Route Parameters
^ array:1 [
  "docRef" => "exploitable-results"
]
Route content-route-1 Template layout/layout

  content: string

Template content/node/node

  node: Content\Entity\Node

Execution Time 454.54 ms
1. route 96.27 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
2. authentication 99.74 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
3. authentication.post 99.97 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
4. authorization 100.10 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
5. authorization.post 100.26 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
6. dispatch 145.96 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
7. dispatch 146.45 ms
File: src/DispatchListener.php - Line: 132
Target: Content\Controller\NodeController
8. render 149.92 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
9. renderer 164.93 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
10. renderer.post 165.03 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
11. renderer 165.10 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
12. renderer.post 165.15 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
13. isAllowed 436.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
14. isAllowed 436.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
15. isAllowed 436.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
16. isAllowed 436.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
17. isAllowed 436.48 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
18. isAllowed 436.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
19. isAllowed 436.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
20. isAllowed 436.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
21. isAllowed 436.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
22. isAllowed 436.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
23. isAllowed 436.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
24. isAllowed 436.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
25. isAllowed 436.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
26. isAllowed 436.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
27. isAllowed 437.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
28. isAllowed 437.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
29. isAllowed 437.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
30. isAllowed 437.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
31. isAllowed 437.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
32. isAllowed 437.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
33. isAllowed 437.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
34. isAllowed 437.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
35. isAllowed 437.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
36. isAllowed 437.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
37. isAllowed 437.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
38. isAllowed 437.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
39. isAllowed 437.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
40. isAllowed 437.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
41. isAllowed 437.96 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
42. isAllowed 438.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
43. isAllowed 438.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
44. isAllowed 438.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
45. isAllowed 438.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
46. isAllowed 438.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
47. isAllowed 438.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
48. isAllowed 438.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
49. isAllowed 438.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
50. isAllowed 438.63 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
51. isAllowed 438.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
52. isAllowed 438.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
53. isAllowed 438.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
54. isAllowed 438.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
55. isAllowed 438.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
56. isAllowed 438.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
57. isAllowed 439.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
58. isAllowed 439.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
59. isAllowed 439.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
60. isAllowed 439.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
61. isAllowed 439.31 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
62. isAllowed 439.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
63. isAllowed 439.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
64. isAllowed 439.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
65. isAllowed 439.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
66. isAllowed 439.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
67. isAllowed 439.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
68. isAllowed 439.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
69. isAllowed 439.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
70. isAllowed 440.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
71. isAllowed 440.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
72. isAllowed 440.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
73. isAllowed 440.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
74. isAllowed 440.43 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
75. isAllowed 440.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
76. isAllowed 441.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
77. isAllowed 441.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
78. isAllowed 441.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
79. isAllowed 441.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
80. isAllowed 441.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
81. isAllowed 441.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
82. isAllowed 441.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
83. isAllowed 441.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
84. isAllowed 441.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
85. isAllowed 442.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
86. isAllowed 442.14 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
87. isAllowed 442.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
88. isAllowed 442.37 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
89. isAllowed 442.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
90. isAllowed 442.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
91. isAllowed 442.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
92. isAllowed 443.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
93. isAllowed 443.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
94. isAllowed 443.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
95. isAllowed 443.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
96. isAllowed 443.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
97. isAllowed 443.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
98. isAllowed 443.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
99. isAllowed 443.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
100. isAllowed 443.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
101. isAllowed 444.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
102. isAllowed 444.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
103. isAllowed 444.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
104. isAllowed 444.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
105. isAllowed 444.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
106. isAllowed 444.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
107. isAllowed 444.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
108. isAllowed 444.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
109. isAllowed 445.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
110. isAllowed 445.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
111. isAllowed 445.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
112. isAllowed 445.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
113. isAllowed 445.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
114. isAllowed 445.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
115. isAllowed 445.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
116. isAllowed 445.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
117. isAllowed 445.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
118. isAllowed 446.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
119. isAllowed 446.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
120. isAllowed 446.34 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
121. isAllowed 446.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
122. isAllowed 446.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
123. isAllowed 446.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
124. isAllowed 446.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
125. isAllowed 447.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
126. isAllowed 447.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
127. isAllowed 447.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
128. isAllowed 447.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
129. isAllowed 447.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
130. isAllowed 447.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
131. isAllowed 447.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
132. isAllowed 447.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
133. isAllowed 448.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
134. isAllowed 448.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
135. isAllowed 448.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
136. isAllowed 448.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
137. isAllowed 448.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
138. isAllowed 448.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
139. isAllowed 449.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
140. isAllowed 449.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
141. isAllowed 449.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
142. isAllowed 449.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
143. isAllowed 449.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
144. isAllowed 449.34 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
145. isAllowed 449.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
146. isAllowed 449.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
147. isAllowed 449.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
148. isAllowed 449.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
149. isAllowed 449.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
150. isAllowed 449.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
151. isAllowed 449.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
152. isAllowed 449.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
153. isAllowed 449.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
154. isAllowed 449.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
155. isAllowed 449.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
156. isAllowed 450.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
157. isAllowed 450.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
158. isAllowed 450.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
159. isAllowed 450.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
160. isAllowed 450.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
161. isAllowed 450.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
162. isAllowed 450.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
163. isAllowed 450.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
164. isAllowed 450.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
165. isAllowed 450.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
166. isAllowed 450.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
167. isAllowed 450.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
168. isAllowed 450.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
169. isAllowed 450.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
170. isAllowed 450.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
171. isAllowed 451.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
172. isAllowed 451.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
173. isAllowed 451.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
174. isAllowed 451.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
175. isAllowed 451.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
176. isAllowed 451.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
177. isAllowed 451.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
178. isAllowed 451.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
179. isAllowed 451.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
180. isAllowed 451.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
181. isAllowed 451.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
182. isAllowed 451.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
183. isAllowed 451.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
184. isAllowed 451.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
185. isAllowed 451.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
186. isAllowed 451.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
187. isAllowed 451.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
188. isAllowed 452.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
189. isAllowed 452.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
190. isAllowed 452.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
191. response 453.66 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
192. finish 453.76 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
193. collected 942.07 ms
File: Listener/ProfilerListener.php - Line: 86
Target: NULL
Total Time 454.54 ms
Memory Peak 2.00 MB
1. route 2.00 MB

public/index.php - Line: 31

2. authentication 2.00 MB

src/EventManager.php - Line: 319

3. authentication.post 2.00 MB

src/EventManager.php - Line: 319

4. authorization 2.00 MB

src/EventManager.php - Line: 319

5. authorization.post 2.00 MB

src/EventManager.php - Line: 319

6. dispatch 2.00 MB

public/index.php - Line: 31

7. dispatch 2.00 MB

src/DispatchListener.php - Line: 132

8. render 2.00 MB

src/Application.php - Line: 341

9. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

10. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

11. renderer 2.00 MB

src/View.php - Line: 222

12. renderer.post 2.00 MB

src/View.php - Line: 222

13. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

14. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

15. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

16. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

17. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

18. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

19. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

20. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

21. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

22. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

23. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

24. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

25. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

26. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

27. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

28. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

29. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

30. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

31. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

32. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

33. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

34. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

35. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

36. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

37. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

38. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

39. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

40. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

41. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

42. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

43. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

44. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

45. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

46. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

47. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

48. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

49. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

50. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

51. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

52. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

53. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

54. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

55. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

56. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

57. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

58. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

59. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

60. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

61. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

62. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

63. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

64. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

65. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

66. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

67. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

68. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

69. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

70. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

71. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

72. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

73. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

74. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

75. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

76. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

77. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

78. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

79. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

80. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

81. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

82. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

83. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

84. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

85. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

86. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

87. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

88. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

89. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

90. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

91. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

92. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

93. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

94. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

95. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

96. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

97. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

98. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

99. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

100. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

101. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

102. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

103. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

104. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

105. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

106. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

107. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

108. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

109. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

110. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

111. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

112. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

113. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

114. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

115. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

116. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

117. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

118. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

119. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

120. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

121. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

122. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

123. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

124. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

125. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

126. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

127. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

128. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

129. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

130. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

131. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

132. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

133. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

134. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

135. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

136. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

137. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

138. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

139. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

140. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

141. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

142. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

143. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

144. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

145. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

146. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

147. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

148. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

149. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

150. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

151. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

152. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

153. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

154. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

155. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

156. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

157. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

158. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

159. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

160. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

161. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

162. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

163. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

164. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

165. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

166. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

167. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

168. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

169. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

170. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

171. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

172. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

173. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

174. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

175. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

176. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

177. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

178. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

179. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

180. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

181. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

182. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

183. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

184. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

185. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

186. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

187. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

188. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

189. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

190. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

191. response 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

192. finish 2.00 MB

src/Application.php - Line: 341

193. collected 2.00 MB

Listener/ProfilerListener.php - Line: 86

Memory Peak 2.00 MB
Config Config
Merged Config (Config)
^ array:66 [
  "service_manager" => array:7 [
    "abstract_factories" => array:11 [
      0 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      1 => "Laminas\Form\FormAbstractServiceFactory"
      2 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      3 => "Laminas\Log\LoggerAbstractServiceFactory"
      4 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      6 => "Laminas\ApiTools\DbConnectedResourceAbstractFactory"
      7 => "Laminas\ApiTools\TableGatewayAbstractFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      8 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      9 => "Laminas\Log\LoggerAbstractServiceFactory"
    ]
    "factories" => array:731 [
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\Navigation\Navigation" => "Laminas\Navigation\Service\DefaultNavigationFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "Laminas\ApiTools\MvcAuth\UnauthenticatedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\UnauthorizedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\Factory\ApiFactoryFactory"
      "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategyFactory"
      "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Factory\RenderErrorListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Factory\SendApiProblemResponseListenerFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemRendererFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemStrategyFactory"
      "Laminas\ApiTools\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\Factory\ConfigResourceFactory"
      "Laminas\ApiTools\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\Factory\ResourceFactoryFactory"
      "Laminas\ApiTools\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\Factory\ConfigWriterFactory"
      "Laminas\ApiTools\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\Factory\ModuleUtilsFactory"
      "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter" => "Application\Authentication\Factory\PdoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Factory\MongoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationServiceFactory"
      "Laminas\ApiTools\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\MvcAuth\Factory\NamedOAuth2ServerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication" => "Laminas\ApiTools\MvcAuth\Factory\AuthenticationServiceFactory"
      "Laminas\ApiTools\MvcAuth\ApacheResolver" => "Laminas\ApiTools\MvcAuth\Factory\ApacheResolverFactory"
      "Laminas\ApiTools\MvcAuth\FileResolver" => "Laminas\ApiTools\MvcAuth\Factory\FileResolverFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthenticationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\AuthHttpAdapter" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthHttpAdapterFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization" => "Laminas\ApiTools\MvcAuth\Factory\AclAuthorizationFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthorizationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultResourceResolverListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultResourceResolverListenerFactory"
      "Laminas\Authentication\Storage\NonPersistent" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Factory\LinkExtractorFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Factory\LinkCollectionExtractorFactory"
      "Laminas\ApiTools\Hal\HalConfig" => "Laminas\ApiTools\Hal\Factory\HalConfigFactory"
      "Laminas\ApiTools\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\Factory\HalJsonRendererFactory"
      "Laminas\ApiTools\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\Factory\HalJsonStrategyFactory"
      "Laminas\ApiTools\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Factory\LinkUrlBuilderFactory"
      "Laminas\ApiTools\Hal\MetadataMap" => "Laminas\ApiTools\Hal\Factory\MetadataMapFactory"
      "Laminas\ApiTools\Hal\RendererOptions" => "Laminas\ApiTools\Hal\Factory\RendererOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentTypeFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentNegotiationOptions" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentNegotiationOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\HttpMethodOverrideListener" => "Laminas\ApiTools\ContentNegotiation\Factory\HttpMethodOverrideListenerFactory"
      "Laminas\ApiTools\ContentValidation\ContentValidationListener" => "Laminas\ApiTools\ContentValidation\ContentValidationListenerFactory"
      "Laminas\ApiTools\Rest\OptionsListener" => "Laminas\ApiTools\Rest\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Rpc\OptionsListener" => "Laminas\ApiTools\Rpc\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\Factory\ContentTypeListenerFactory"
      "Laminas\ApiTools\Versioning\VersionListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Api\V1\Rest\ContactResource\MeListener" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "LmcCors\Mvc\CorsRequestListener" => "LmcCors\Factory\CorsRequestListenerFactory"
      "LmcCors\Options\CorsOptions" => "LmcCors\Factory\CorsOptionsFactory"
      "LmcCors\Service\CorsService" => "LmcCors\Factory\CorsServiceFactory"
      "AssetManager\Service\AssetManager" => "AssetManager\Service\AssetManagerServiceFactory"
      "AssetManager\Service\AssetFilterManager" => "AssetManager\Service\AssetFilterManagerServiceFactory"
      "AssetManager\Service\AssetCacheManager" => "AssetManager\Service\AssetCacheManagerServiceFactory"
      "AssetManager\Resolver\AggregateResolver" => "AssetManager\Service\AggregateResolverServiceFactory"
      "AssetManager\Resolver\MapResolver" => "AssetManager\Service\MapResolverServiceFactory"
      "AssetManager\Resolver\PathStackResolver" => "AssetManager\Service\PathStackResolverServiceFactory"
      "AssetManager\Resolver\PrioritizedPathsResolver" => "AssetManager\Service\PrioritizedPathsResolverServiceFactory"
      "AssetManager\Resolver\CollectionResolver" => "AssetManager\Service\CollectionResolverServiceFactory"
      "AssetManager\Resolver\ConcatResolver" => "AssetManager\Service\ConcatResolverServiceFactory"
      "AssetManager\Resolver\AliasPathStackResolver" => "AssetManager\Service\AliasPathStackResolverServiceFactory"
      "Twig\Environment" => "ZfcTwig\Twig\EnvironmentFactory"
      "Twig\Loader\ChainLoader" => "ZfcTwig\Twig\ChainLoaderFactory"
      "ZfcTwig\Twig\Extension" => "ZfcTwig\Twig\ExtensionFactory"
      "ZfcTwig\Twig\MapLoader" => "ZfcTwig\Twig\MapLoaderFactory"
      "ZfcTwig\Twig\StackLoader" => "ZfcTwig\Twig\StackLoaderFactory"
      "ZfcTwig\View\TwigRenderer" => "ZfcTwig\View\TwigRendererFactory"
      "ZfcTwig\View\TwigResolver" => "ZfcTwig\View\TwigResolverFactory"
      "ZfcTwig\View\HelperPluginManager" => "ZfcTwig\View\HelperPluginManagerFactory"
      "ZfcTwig\View\TwigStrategy" => "ZfcTwig\View\TwigStrategyFactory"
      "ZfcTwig\ModuleOptions" => "ZfcTwig\ModuleOptionsFactory"
      "BjyAuthorize\Cache" => "BjyAuthorize\Service\CacheFactory"
      "BjyAuthorize\CacheKeyGenerator" => "BjyAuthorize\Service\CacheKeyGeneratorFactory"
      "BjyAuthorize\Config" => "Jield\Authorize\Factory\ConfigServiceFactory"
      "BjyAuthorize\Guards" => "BjyAuthorize\Service\GuardsServiceFactory"
      "BjyAuthorize\RoleProviders" => "BjyAuthorize\Service\RoleProvidersServiceFactory"
      "BjyAuthorize\ResourceProviders" => "BjyAuthorize\Service\ResourceProvidersServiceFactory"
      "BjyAuthorize\RuleProviders" => "BjyAuthorize\Service\RuleProvidersServiceFactory"
      "BjyAuthorize\Service\RoleDbTableGateway" => "BjyAuthorize\Service\UserRoleServiceFactory"
      "BjyAuthorize\Collector\RoleCollector" => "BjyAuthorize\Service\RoleCollectorServiceFactory"
      "BjyAuthorize\Guard\Controller" => "BjyAuthorize\Service\ControllerGuardServiceFactory"
      "BjyAuthorize\Guard\Route" => "BjyAuthorize\Service\RouteGuardServiceFactory"
      "BjyAuthorize\Provider\Identity\AuthenticationIdentityProvider" => "BjyAuthorize\Service\AuthenticationIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\LmcUserLaminasDb" => "BjyAuthorize\Service\LmcUserLaminasDbIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\ProviderInterface" => "BjyAuthorize\Service\IdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Resource\Config" => "BjyAuthorize\Service\ConfigResourceProviderServiceFactory"
      "BjyAuthorize\Provider\Role\Config" => "BjyAuthorize\Service\ConfigRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\LaminasDb" => "BjyAuthorize\Service\LaminasDbRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\ObjectRepositoryProvider" => "BjyAuthorize\Service\ObjectRepositoryRoleProviderFactory"
      "BjyAuthorize\Provider\Rule\Config" => "BjyAuthorize\Service\ConfigRuleProviderServiceFactory"
      "BjyAuthorize\Service\Authorize" => "BjyAuthorize\Service\AuthorizeFactory"
      "BjyAuthorize\View\UnauthorizedStrategy" => "BjyAuthorize\Service\UnauthorizedStrategyServiceFactory"
      "Jield\Authorize\View\UnauthorizedStrategy" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Jield\Authorize\Service\AuthorizeService" => "Jield\Authorize\Factory\AuthorizeServiceFactory"
      "Jield\Authorize\Service\AssertionService" => "Jield\Authorize\Factory\AssertionServiceFactory"
      "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider" => "Jield\Authorize\Factory\AuthenticationIdentityProviderFactory"
      "Jield\Authorize\Rule\RulesWithAssertion" => "Jield\Authorize\Factory\RuleWithAssertionFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "doctrine.cache.application_cache" => "Application\Factory\StorageCacheFactory"
      "Laminas\Cache\Storage\Adapter\Redis" => "Application\Factory\LaminasCacheFactory"
      "Application\Event\InjectAclInNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\SetTitle" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Application\Event\BlockInactiveContact" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\RegisterPageview" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\I18n\Translator\TranslatorInterface" => "Application\Factory\TranslatorServiceFactory"
      "Application\Service\FormService" => "Application\Factory\FormServiceFactory"
      "Application\Options\ModuleOptions" => "Application\Factory\ModuleOptionsFactory"
      "Application\Authentication\Storage\AuthenticationStorage" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Authentication\AuthenticationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Session\SaveHandler\DoctrineGateway" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Twig\DatabaseTwigLoader" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "cms_navigation" => "Content\Navigation\Factory\ContentNavigationFactory"
      "Content\Service\ContentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\NodeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\VimeoService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\ArticleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\RouteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Event\InitRoutes" => "Application\Factory\InvokableFactory"
      "Content\InputFilter\HandlerFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\RouteFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\SegmentFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TopicFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Options\ModuleOptions" => "Content\Factory\ModuleOptionsFactory"
      "Content\Navigation\Service\ContentNavigationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ContentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\HandlerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\NodeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ParamLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\RouteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\SegmentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Content\Acl\Assertion\Node" => "Application\Factory\InvokableFactory"
      "General\Options\ModuleOptions" => "General\Factory\ModuleOptionsFactory"
      "General\Options\EmailOptions" => "General\Factory\EmailOptionsFactory"
      "General\InputFilter\ChallengeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\Challenge\TypeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\CountryFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\GenderFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\LanguageFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\ExchangeRateFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\TitleFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\WebInfoFilter" => "Application\Factory\InputFilterFactory"
      "General\Service\GeneralService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\CountryService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\EmailService" => "Application\Factory\InvokableFactory"
      "General\Search\Service\CountrySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Mail\Transport\Smtp" => "General\Factory\SmtpTransportFactory"
      "Laminas\Mail\Transport\Sendmail" => "General\Factory\SendmailTransportFactory"
      "Mailjet\Client" => "General\Factory\MailjetClientFactory"
      "General\Navigation\Invokable\ChallengeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ChallengeTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ContentTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\EmailMessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\Country\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LanguageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CurrencyLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\PasswordLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\GenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\TitleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\WebInfoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Cluster\Command\UpdateProject" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Command\GenerateProjectJson" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Options\ModuleOptions" => "Cluster\Factory\ModuleOptionsFactory"
      "Cluster\Acl\Assertion\ClusterAssertion" => "Application\Factory\InvokableFactory"
      "Cluster\Form\ClusterForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\InputFilter\ClusterFilter" => "Application\Factory\InputFilterFactory"
      "Cluster\Service\ClusterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Navigation\Invokable\ClusterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Service\NewsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\BlogService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\MagazineService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\InputFilter\Blog\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\Blog\TagFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\News\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\MagazineFilter" => "Application\Factory\InputFilterFactory"
      "News\Acl\Assertion\Magazine" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Magazine\Article" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Blog" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\News" => "Application\Factory\InvokableFactory"
      "News\Search\Service\NewsSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Search\Service\BlogSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Navigation\Invokable\BlogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\TagLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\NewsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\News\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\MagazineLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Magazine\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Command\ResetAccess" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Provider\ContactProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Contact\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\FacebookLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\OptInLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\AddressLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\DndLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\NoteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\PhoneLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Selection\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\LeaveLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\SelectionContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\AddressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\Office\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\ContactForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\InputFilter\AddressFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\PhoneFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\FacebookFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\DndFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\OptInFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Selection\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\LeaveFilter" => "Application\Factory\InputFilterFactory"
      "Contact\Search\Service\ContactSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Search\Service\ProfileSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Acl\Assertion\Address" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Profile" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Facebook" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Note" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Phone" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Selection" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\ContactAssertion" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\LeaveAssertion" => "Application\Factory\InvokableFactory"
      "Quality\Service\QualityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\Navigation\Invokable\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\SourceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\PhaseLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\YearLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\KpiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\PhaseFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\YearFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\KpiFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\TargetFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\Provider\ProjectProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Provider\Version\VersionProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Acl\Assertion\ChangeRequest\CostChange" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Country" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Process" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Description\Description" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Document\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool\Session" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Idea" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Image" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Partner" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Video" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Poster\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Item" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WorkpackageDescription" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Report" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WindowAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Window\ProjectAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Result\Result" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Version" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Task" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Workpackage" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResultAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\LinkAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\DocumentAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Action" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Pca" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Help" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\HelpFaq" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Log" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Project" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Rationale" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Roadmap" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Calendar\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Project\Service\ProjectService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\KeywordService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AchievementService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Achievement\ExploitableResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionDocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Report\WindowService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\WorkpackageService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ContractService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DescriptionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\IdeaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\Tool\SessionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\HelpService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\InviteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ChangeRequestService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ActionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AwardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\EventService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\ProjectForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\Deliverable\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DeliverableFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\TaskFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AchievementFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\ExploitableResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ProjectFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Action\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AwardFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Award\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CostChangeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Document\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Description\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Event\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\ReportFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\WorkpackageDescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\RationaleFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\Version\VersionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\IdeaFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\ToolFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Description\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Tool\SessionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\FeeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\LogFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\HelpFilter" => "Application\Factory\InputFilterFactory"
      "Project\Options\ModuleOptions" => "Project\Factory\ModuleOptionsFactory"
      "Project\Navigation\Service\HelpNavigationService" => "Project\Navigation\Factory\HelpNavigationServiceFactory"
      "Project\Navigation\Invokable\AchievementLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinkLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinksLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Link\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Document\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\AwardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Award\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CostChangeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\RationaleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Document\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ContractLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Contract\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\FeeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpFaqLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\IdeaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\ToolLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Tool\SessionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Description\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PartnerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Meeting\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Poster\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\ItemLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WorkpackageDescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\Type\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Version\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\WorkpackageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\TaskLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DeliverableLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CalendarReviewLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Search\Service\AchievementSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\Achievement\ExploitableResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\IdeaSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\DescriptionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ProjectSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\WorkpackageDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ActionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Acl\Assertion\FeedbackAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\EvaluationAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReportAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\InputFilter\Report\Criterion\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TopicFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\Service\EvaluationReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\EvaluationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewRosterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewerService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\CriterionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Reviewer\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluateProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\FeedbackLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Options\ModuleOptions" => "Evaluation\Options\Factory\ModuleOptionsFactory"
      "Press\Service\PressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Search\Service\PressSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Press\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Press\Navigation\Invokable\BureauLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Service\ProgramService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\Service\CallService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\ProgramFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\FunderFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CallFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Program\Options\ModuleOptions" => "Program\Factory\ModuleOptionsFactory"
      "Program\Acl\Assertion\Doa" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Funder" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Nda" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Call\Country" => "Application\Factory\InvokableFactory"
      "Program\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Program\Navigation\Invokable\CallLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\FunderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\NdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\ProgramLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\UploadNdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Search\Command\UpdateIndex" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Search\Service\ConsoleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\AdminService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\QueueService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\ApiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\OAuth2Service" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\InputFilter\AccessFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Navigation\Invokable\AccessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ClientLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ScopeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\EntityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\RoleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\SetterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Api\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\QueueLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Provider\AffiliationProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\AffiliationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\QuestionnaireService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\DoaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\LoiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\InputFilter\AffiliationFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\Options\ModuleOptions" => "Affiliation\Factory\ModuleOptionsFactory"
      "Affiliation\Acl\Assertion\AffiliationAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\LoiAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\QuestionnaireAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Navigation\Invokable\AffiliationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\LoiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionnaireLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Options\ModuleOptions" => "Organisation\Factory\ModuleOptionsFactory"
      "Organisation\Form\OrganisationForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\CityForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\SolutionForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\UpdateForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\FinancialForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\OrganisationService" => "Application\Factory\InvokableFactory"
      "Organisation\Service\UpdateService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\BoardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\CityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\SolutionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\ParentService" => "Application\Factory\InvokableFactory"
      "Organisation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\BoardFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\OrganisationFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\ParentEntityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\Parent\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\CityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\SolutionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\Acl\Assertion\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\NoteAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\ParentAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\UpdateAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\FinancialAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\CityAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\SolutionAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Search\Service\OrganisationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Navigation\Invokable\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\BoardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\ParentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\UpdateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\FinancialLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\CityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\SolutionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Service\PublicationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\InputFilter\PublicationFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Publication\Search\Service\PublicationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\Acl\Assertion\Publication" => "Application\Factory\InvokableFactory"
      "Publication\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Publication\Navigation\Invokable\PublicationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeCategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Command\DailyUpdate" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Command\Sync" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\TransactionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\InvoiceService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Options\ModuleOptions" => "Invoice\Factory\ModuleOptionsFactory"
      "Invoice\Search\Service\InvoiceSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Acl\Assertion\Invoice" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Journal" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Method" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Pdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Reminder" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\ReminderPdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Row" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Transaction" => "Application\Factory\InvokableFactory"
      "Invoice\Navigation\Invokable\InvoiceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\JournalLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\TransactionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\ReminderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\RowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\VatDimensionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Deeplink\Service\DeeplinkService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\InputFilter\TargetFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Command\CancelPaymentPending" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Command\UpdateRegistrations" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Navigation\Invokable\BoothLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BoothSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskCostsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\CouponLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationDeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingQuotaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingFloorplanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\TicketLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Service\BadgeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\BoothService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\RegistrationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionFloorplanService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionSpecService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\InputFilter\Badge\AttachmentFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\DeskCostsFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\QuotaFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\OptionCostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\ExhibitionFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\SpecFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Booth\BoothFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\RegistrationFilter" => "Application\Factory\InputFilterFactory"
      "Event\Options\ModuleOptions" => "Event\Factory\ModuleOptionsFactory"
      "Event\Options\CometChatApiOptions" => "Event\Factory\CometChatApiOptionsFactory"
      "Event\Search\Service\RegistrationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Acl\Assertion\Badge" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Booth" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\BoothSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Exhibition" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\ExhibitionSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Meeting" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\MeetingFloorplan" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Registration" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Ticket" => "Application\Factory\InvokableFactory"
      "Calendar\Service\CalendarService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Options\ModuleOptions" => "Calendar\Factory\ModuleOptionsFactory"
      "Calendar\Acl\Assertion\Calendar" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Document" => "Application\Factory\InvokableFactory"
      "Calendar\Search\Service\CalendarSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Navigation\Invokable\CalendarLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Calendar\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Command\FlushQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Command\SendQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Service\MailingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\MailingFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\SenderFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Navigation\Invokable\MailingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\SenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "LaminasGoogleAnalytics\Analytics\Tracker" => "LaminasGoogleAnalytics\Service\TrackerFactory"
      "LaminasGoogleAnalytics\Service\ScriptFactory" => "LaminasGoogleAnalytics\Service\ScriptFactory"
      "Accounting\Adapter\TwinfieldAdapter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Accounting\Options\ModuleOptions" => "Accounting\Factory\ModuleOptionsFactory"
      "ErrorHeroModule\Listener\Mvc" => "ErrorHeroModule\Listener\MvcFactory"
      "ErrorHeroModule\Handler\Logging" => "ErrorHeroModule\Handler\LoggingFactory"
      "SlmQueue\Job\JobPluginManager" => "SlmQueue\Factory\JobPluginManagerFactory"
      "SlmQueue\Strategy\StrategyPluginManager" => "SlmQueue\Factory\StrategyPluginManagerFactory"
      "SlmQueue\Queue\QueuePluginManager" => "SlmQueue\Factory\QueuePluginManagerFactory"
      "SlmQueue\Worker\WorkerPluginManager" => "SlmQueue\Factory\WorkerPluginManagerFactory"
      "SlmQueue\Command\StartWorkerCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
      "SlmQueueDoctrine\Command\RecoverJobsCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
    ]
    "aliases" => array:81 [
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "navigation" => "Laminas\Navigation\Navigation"
      "Zend\Navigation\Navigation" => "Laminas\Navigation\Navigation"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
      "ZF\Apigility\MvcAuth\UnauthenticatedListener" => "Laminas\ApiTools\MvcAuth\UnauthenticatedListener"
      "ZF\Apigility\MvcAuth\UnauthorizedListener" => "Laminas\ApiTools\MvcAuth\UnauthorizedListener"
      "ZF\Apigility\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\ApiFactory"
      "ZF\Apigility\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy"
      "Laminas\ApiTools\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "Laminas\ApiTools\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "Laminas\ApiTools\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "Laminas\ApiTools\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\ApiProblemListener"
      "ZF\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\RenderErrorListener"
      "ZF\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\ApiProblemRenderer"
      "ZF\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\ApiProblemStrategy"
      "ZF\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "ZF\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "ZF\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener"
      "ZF\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "ZF\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\ConfigResource"
      "ZF\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\ConfigResourceFactory"
      "ZF\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\ConfigWriter"
      "ZF\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\ModuleUtils"
      "Laminas\ApiTools\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId"
      "ZF\OAuth2\Adapter\PdoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
      "ZF\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter"
      "ZF\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\OAuth2\Service\OAuth2Server"
      "authentication" => "Laminas\ApiTools\MvcAuth\Authentication"
      "authorization" => "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface"
      "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface" => "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization"
      "ZF\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkExtractor"
      "ZF\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor"
      "ZF\Hal\HalConfig" => "Laminas\ApiTools\Hal\HalConfig"
      "ZF\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\JsonRenderer"
      "ZF\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\JsonStrategy"
      "ZF\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Link\LinkUrlBuilder"
      "ZF\Hal\MetadataMap" => "Laminas\ApiTools\Hal\MetadataMap"
      "ZF\Hal\RendererOptions" => "Laminas\ApiTools\Hal\RendererOptions"
      "ZF\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\AcceptListener"
      "ZF\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\ContentTypeListener"
      "ZF\Versioning\VersionListener" => "Laminas\ApiTools\Versioning\VersionListener"
      "mime_resolver" => "AssetManager\Service\MimeResolver"
      "AssetManager\Service\AggregateResolver" => "AssetManager\Resolver\AggregateResolver"
      "ZfcTwigExtension" => "ZfcTwig\Twig\Extension"
      "ZfcTwigLoaderChain" => "Twig\Loader\ChainLoader"
      "ZfcTwigLoaderTemplateMap" => "ZfcTwig\Twig\MapLoader"
      "ZfcTwigLoaderTemplatePathStack" => "ZfcTwig\Twig\StackLoader"
      "ZfcTwigRenderer" => "ZfcTwig\View\TwigRenderer"
      "ZfcTwigResolver" => "ZfcTwig\View\TwigResolver"
      "ZfcTwigViewHelperManager" => "ZfcTwig\View\HelperPluginManager"
      "ZfcTwigViewStrategy" => "ZfcTwig\View\TwigStrategy"
      "bjyauthorize_zend_db_adapter" => "Laminas\Db\Adapter\Adapter"
      "BjyAuthorize\Service\Authorize" => "Jield\Authorize\Service\AuthorizeService"
      "BjyAuthorize\Cache" => "Laminas\Cache\Storage\Adapter\Redis"
      "google-analytics" => "LaminasGoogleAnalytics\Analytics\Tracker"
      "google-analytics-universal" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "google-analytics-ga" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "delegators" => array:2 [
      "ViewHelperManager" => array:1 [ …1]
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => array:1 [ …1]
    ]
    "invokables" => array:44 [
      "Laminas\ApiTools\Rest\RestParametersListener" => "Laminas\ApiTools\Rest\Listener\RestParametersListener"
      "AssetManager\Service\MimeResolver" => "AssetManager\Service\MimeResolver"
      0 => "BjyAuthorize\View\RedirectionStrategy"
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
      "Content\InputFilter\ArticleFilter" => "Content\InputFilter\ArticleFilter"
      "Content\InputFilter\ContentFilter" => "Content\InputFilter\ContentFilter"
      "Content\InputFilter\ContentParamFilter" => "Content\InputFilter\ContentParamFilter"
      "Content\InputFilter\NodeFilter" => "Content\InputFilter\NodeFilter"
      "Content\InputFilter\ParamFilter" => "Content\InputFilter\ParamFilter"
      1 => "General\InputFilter\PasswordFilter"
      2 => "Cluster\Provider\ClusterProvider"
      3 => "News\InputFilter\NewsFilter"
      4 => "News\InputFilter\BlogFilter"
      5 => "News\InputFilter\Blog\MessageFilter"
      6 => "News\InputFilter\Magazine\ArticleFilter"
      7 => "Press\InputFilter\ArticleFilter"
      8 => "Press\InputFilter\BureauFilter"
      9 => "Program\InputFilter\Call\CallFilter"
      10 => "Program\InputFilter\Call\CountryFilter"
      11 => "Program\InputFilter\DoaFilter"
      12 => "Program\InputFilter\FunderFilter"
      13 => "Admin\InputFilter\Permit\RoleFilter"
      14 => "Organisation\InputFilter\NoteFilter"
      15 => "Invoice\InputFilter\InvoiceFilter"
      16 => "Invoice\InputFilter\RowFilter"
      "Calendar\InputFilter\CalendarFilter" => "Calendar\InputFilter\CalendarFilter"
      "Calendar\InputFilter\DocumentFilter" => "Calendar\InputFilter\DocumentFilter"
      "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "LaminasGoogleAnalytics\View\Helper\Script\Gajs" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "initializers" => array:1 [
      0 => "BjyAuthorize\Service\AuthorizeAwareServiceInitializer"
    ]
    "shared" => array:1 [
      "Contact\Service\ContactService" => false
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:15 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
      "cluster:update-project" => "Cluster\Command\UpdateProject"
      "cluster:generate-project-json" => "Cluster\Command\GenerateProjectJson"
      "contact:cleanup" => "Contact\Command\Cleanup"
      "contact:reset-access" => "Contact\Command\ResetAccess"
      "search:update-index" => "Search\Command\UpdateIndex"
      "organisation:cleanup" => "Organisation\Command\Cleanup"
      "invoice:sync" => "Invoice\Command\Sync"
      "invoice:daily-update" => "Invoice\Command\DailyUpdate"
      "event:update-registrations" => "Event\Command\UpdateRegistrations"
      "event:cancel-payment-pending" => "Event\Command\CancelPaymentPending"
      "mailing:send-queue" => "Mailing\Command\SendQueue"
      "mailing:flush-queue" => "Mailing\Command\FlushQueue"
      "slm-queue:start" => "SlmQueue\Command\StartWorkerCommand"
      "slm-queue:doctrine:recover" => "SlmQueueDoctrine\Command\RecoverJobsCommand"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:28 [
      "api-tools" => array:4 [ …4]
      "oauth" => array:4 [ …4]
      "api" => array:4 [ …4]
      "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
      "doctrine_orm_module_yuml" => array:2 [ …2]
      "zfcadmin" => array:5 [ …5]
      "home" => array:3 [ …3]
      "my" => array:3 [ …3]
      "redirect" => array:5 [ …5]
      "image" => array:4 [ …4]
      "country" => array:5 [ …5]
      "impact-stream" => array:5 [ …5]
      "challenge" => array:4 [ …4]
      "email" => array:5 [ …5]
      "community" => array:5 [ …5]
      "magazine" => array:4 [ …4]
      "annual-report" => array:4 [ …4]
      "json" => array:4 [ …4]
      "assets" => array:4 [ …4]
      "project" => array:5 [ …5]
      "press" => array:4 [ …4]
      "search" => array:3 [ …3]
      "oauth2" => array:4 [ …4]
      "user" => array:5 [ …5]
      "organisation" => array:5 [ …5]
      "publication" => array:5 [ …5]
      "deeplink" => array:3 [ …3]
      "error-preview" => array:2 [ …2]
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:504 [
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "agacceptheaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agcontenttypeheaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agservicepath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agstatuscodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agtransformdescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "agTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "ZF\Apigility\Documentation\View\AgAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "ZF\Apigility\Documentation\View\AgContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "ZF\Apigility\Documentation\View\AgServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "ZF\Apigility\Documentation\View\AgStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "ZF\Apigility\Documentation\View\AgTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "asset" => "AssetManager\View\Helper\Asset"
      "nodeLink" => "Content\View\Helper\NodeLink"
      "paramLink" => "Content\View\Helper\ParamLink"
      "handlerLink" => "Content\View\Helper\HandlerLink"
      "segmentLink" => "Content\View\Helper\SegmentLink"
      "templateLink" => "Content\View\Helper\TemplateLink"
      "contentLink" => "Content\View\Helper\ContentLink"
      "routeLink" => "Content\View\Helper\RouteLink"
      "topicLink" => "Content\View\Helper\TopicLink"
      "articleLink" => "Content\View\Helper\ArticleLink"
      "nodeTableRow" => "Content\View\Helper\NodeTableRow"
      "imageLink" => "Content\View\Helper\ImageLink"
      "image" => "Content\View\Helper\Image"
      "videoLink" => "Content\View\Helper\VideoLink"
      "video" => "Content\View\Helper\Video"
      "paginationLink" => "Content\View\Helper\PaginationLink"
      "imageHandler" => "Content\View\Handler\ImageHandler"
      "contentHandler" => "Content\View\Handler\ContentHandler"
      "buildNavigation" => "Content\View\Helper\BuildNavigation"
      "challengeHandler" => "General\View\Handler\ChallengeHandler"
      "challengeIcon" => "General\View\Helper\Challenge\ChallengeIcon"
      "challengeImage" => "General\View\Helper\Challenge\ChallengeImage"
      "challengeIdeaPosterImage" => "General\View\Helper\Challenge\Idea\Poster\Image"
      "challengeIdeaPosterIcon" => "General\View\Helper\Challenge\Idea\Poster\Icon"
      "challengeTypeLink" => "General\View\Helper\Challenge\TypeLink"
      "countryMap" => "General\View\Helper\Country\CountryMap"
      "countryFlag" => "General\View\Helper\Country\CountryFlag"
      "countryLink" => "General\View\Helper\Country\CountryLink"
      "countryVideoLink" => "General\View\Helper\Country\VideoLink"
      "languageLink" => "General\View\Helper\LanguageLink"
      "currencyLink" => "General\View\Helper\CurrencyLink"
      "exchangeRateLink" => "General\View\Helper\ExchangeRateLink"
      "passwordLink" => "General\View\Helper\PasswordLink"
      "emailMessageLink" => "General\View\Helper\EmailMessageLink"
      "generalLogLink" => "General\View\Helper\LogLink"
      "vatLink" => "General\View\Helper\VatLink"
      "genderLink" => "General\View\Helper\GenderLink"
      "titleLink" => "General\View\Helper\TitleLink"
      "vatTypeLink" => "General\View\Helper\VatTypeLink"
      "challengeLink" => "General\View\Helper\Challenge\ChallengeLink"
      "webInfoLink" => "General\View\Helper\WebInfoLink"
      "contentTypeLink" => "General\View\Helper\ContentTypeLink"
      "contentTypeIcon" => "General\View\Helper\ContentTypeIcon"
      "countryselect" => "General\Form\View\Helper\CountrySelect"
      "clusterLink" => "Cluster\View\Helper\ClusterLink"
      "clusterLogo" => "Cluster\View\Helper\Cluster\Logo"
      "blogLink" => "News\View\Helper\BlogLink"
      "blogMessageLink" => "News\View\Helper\Blog\MessageLink"
      "blogTagLink" => "News\View\Helper\Blog\TagLink"
      "blogCategoryLink" => "News\View\Helper\Blog\CategoryLink"
      "newsLink" => "News\View\Helper\NewsLink"
      "newsCategoryLink" => "News\View\Helper\News\CategoryLink"
      "magazineLink" => "News\View\Helper\MagazineLink"
      "magazineArticleLink" => "News\View\Helper\Magazine\ArticleLink"
      "blogselect" => "News\Form\View\Helper\BlogSelect"
      "contactLink" => "Contact\View\Helper\ContactLink"
      "officeContactLink" => "Contact\View\Helper\Office\ContactLink"
      "leaveLink" => "Contact\View\Helper\Office\LeaveLink"
      "dndLink" => "Contact\View\Helper\DndLink"
      "profileLink" => "Contact\View\Helper\ProfileLink"
      "selectionLink" => "Contact\View\Helper\SelectionLink"
      "selectionTypeLink" => "Contact\View\Helper\Selection\TypeLink"
      "facebookLink" => "Contact\View\Helper\FacebookLink"
      "optInLink" => "Contact\View\Helper\OptInLink"
      "addressLink" => "Contact\View\Helper\AddressLink"
      "noteLink" => "Contact\View\Helper\NoteLink"
      "phoneLink" => "Contact\View\Helper\PhoneLink"
      "contactPhoto" => "Contact\View\Helper\ContactPhoto"
      "contactformelement" => "Contact\Form\View\Helper\ContactFormElement"
      "selectionformelement" => "Contact\Form\View\Helper\SelectionFormElement"
      "qualityActionLink" => "Quality\View\Helper\ActionLink"
      "qualityProcessLink" => "Quality\View\Helper\ProcessLink"
      "qualityStatusLink" => "Quality\View\Helper\StatusLink"
      "qualityStatusBadge" => "Quality\View\Helper\StatusBadge"
      "qualityPhaseLink" => "Quality\View\Helper\PhaseLink"
      "qualityYearLink" => "Quality\View\Helper\YearLink"
      "qualityTargetLink" => "Quality\View\Helper\TargetLink"
      "qualityKpiLink" => "Quality\View\Helper\KpiLink"
      "qualityKpiTargetLink" => "Quality\View\Helper\Kpi\TargetLink"
      "qualityKpiGroupLink" => "Quality\View\Helper\Kpi\GroupLink"
      "qualityKpiResultLink" => "Quality\View\Helper\Kpi\ResultLink"
      "qualityKpiResultMatrix" => "Quality\View\Helper\Kpi\Result\Matrix"
      "qualityActionSourceLink" => "Quality\View\Helper\Action\SourceLink"
      "qualityActionGroupLink" => "Quality\View\Helper\Action\GroupLink"
      "qualityActionResultMatrix" => "Quality\View\Helper\Action\Result\Matrix"
      "projectLogo" => "Project\View\Helper\Project\ProjectLogo"
      "projectQuickstart" => "Project\View\Helper\Project\Quickstart"
      "projectStatusIcon" => "Project\View\Helper\Project\StatusIcon"
      "projectDates" => "Project\View\Helper\Project\ProjectDates"
      "projectInviteLink" => "Project\View\Helper\Project\InviteLink"
      "projectSelectionLink" => "Project\View\Helper\SelectionLink"
      "ideaImage" => "Project\View\Helper\Idea\IdeaImage"
      "toolSessionLink" => "Project\View\Helper\Idea\Tool\SessionLink"
      "helpLink" => "Project\View\Helper\HelpLink"
      "logLink" => "Project\View\Helper\LogLink"
      "pcaLink" => "Project\View\Helper\PcaLink"
      "helpFaqLink" => "Project\View\Helper\HelpFaqLink"
      "projectLink" => "Project\View\Helper\Project\ProjectLink"
      "documentLink" => "Project\View\Helper\Document\DocumentLink"
      "documentTypeLink" => "Project\View\Helper\Document\TypeLink"
      "versionLink" => "Project\View\Helper\Version\VersionLink"
      "versionDocumentLink" => "Project\View\Helper\Version\DocumentLink"
      "versionReviewerLink" => "Project\View\Helper\Version\ReviewerLink"
      "resultCategoryLink" => "Project\View\Helper\Result\CategoryLink"
      "resultTypeLink" => "Project\View\Helper\Result\TypeLink"
      "resultLink" => "Project\View\Helper\ResultLink"
      "reportLink" => "Project\View\Helper\Report\ReportLink"
      "reportHelper" => "Project\View\Helper\Report\ReportHelper"
      "reportItemLink" => "Project\View\Helper\Report\ItemLink"
      "reportReviewerLink" => "Project\View\Helper\Report\ReviewerLink"
      "projectReportWindowLink" => "Project\View\Helper\Report\WindowLink"
      "projectReportWindowProjectLink" => "Project\View\Helper\Report\Window\ProjectLink"
      "reportWorkpackageDescriptionLink" => "Project\View\Helper\Report\WorkpackageDescriptionLink"
      "workpackageLink" => "Project\View\Helper\Workpackage\WorkpackageLink"
      "workpackageDocumentLink" => "Project\View\Helper\Workpackage\DocumentLink"
      "workpackageTaskLink" => "Project\View\Helper\Workpackage\TaskLink"
      "workpackageDeliverableLink" => "Project\View\Helper\Workpackage\DeliverableLink"
      "workpackageDescriptionLink" => "Project\View\Helper\Workpackage\DescriptionLink"
      "workpackageDeliverableDocumentLink" => "Project\View\Helper\Workpackage\Deliverable\DocumentLink"
      "workpackageDeliverableTypeLink" => "Project\View\Helper\Workpackage\Deliverable\TypeLink"
      "posterLink" => "Project\View\Helper\PosterLink"
      "feeLink" => "Project\View\Helper\FeeLink"
      "ideaLink" => "Project\View\Helper\Idea\IdeaLink"
      "ideaToolLink" => "Project\View\Helper\Idea\ToolLink"
      "ideaInviteLink" => "Project\View\Helper\Idea\InviteLink"
      "ideaDescriptionLink" => "Project\View\Helper\Idea\DescriptionLink"
      "ideaPartnerLink" => "Project\View\Helper\Idea\PartnerLink"
      "ideaPosterLink" => "Project\View\Helper\Idea\PosterLink"
      "ideaPosterAttachment" => "Project\View\Helper\Idea\Poster\Attachment"
      "ideaPosterThumbnail" => "Project\View\Helper\Idea\Poster\Thumbnail"
      "ideaDocumentLink" => "Project\View\Helper\Idea\DocumentLink"
      "ideaImageLink" => "Project\View\Helper\Idea\ImageLink"
      "ideaVideoLink" => "Project\View\Helper\Idea\VideoLink"
      "ideaMeetingLink" => "Project\View\Helper\Idea\MeetingLink"
      "ideaMeetingInviteLink" => "Project\View\Helper\Idea\Meeting\InviteLink"
      "ideaMessageLink" => "Project\View\Helper\Idea\MessageLink"
      "ideaMessageDocumentLink" => "Project\View\Helper\Idea\Message\DocumentLink"
      "ideaStatusLink" => "Project\View\Helper\Idea\StatusLink"
      "ideaStatusDocumentLink" => "Project\View\Helper\Idea\Status\DocumentLink"
      "ideaDescriptionTypeLink" => "Project\View\Helper\Idea\Description\TypeLink"
      "buildHelp" => "Project\View\Helper\BuildHelp"
      "descriptionLink" => "Project\View\Helper\DescriptionLink"
      "buildDescription" => "Project\View\Helper\Description\BuildTree"
      "buildDescriptionNavigation" => "Project\View\Helper\Description\BuildNavigation"
      "buildDescriptionContent" => "Project\View\Helper\Description\BuildContent"
      "rationaleLink" => "Project\View\Helper\RationaleLink"
      "achievementLink" => "Project\View\Helper\Achievement\AchievementLink"
      "achievementTypeLink" => "Project\View\Helper\Achievement\TypeLink"
      "achievementCategoryLink" => "Project\View\Helper\Achievement\CategoryLink"
      "achievementExploitableResultLink" => "Project\View\Helper\Achievement\ExploitableResultLink"
      "achievementExploitableResultLinkLink" => "Project\View\Helper\Achievement\ExploitableResult\LinkLink"
      "achievementExploitableResultDocumentLink" => "Project\View\Helper\Achievement\ExploitableResult\DocumentLink"
      "changeRequestProcessLink" => "Project\View\Helper\ChangeRequest\ProcessLink"
      "changeRequestCostChangeLink" => "Project\View\Helper\ChangeRequest\CostChangeLink"
      "changeRequestCountryLink" => "Project\View\Helper\ChangeRequest\CountryLink"
      "projectCalendarReviewerLink" => "Project\View\Helper\Project\CalendarReviewerLink"
      "projectContractLink" => "Project\View\Helper\Contract\ContractLink"
      "contractDocumentLink" => "Project\View\Helper\Contract\DocumentLink"
      "contractVersionLink" => "Project\View\Helper\Contract\VersionLink"
      "contractVersionDocumentLink" => "Project\View\Helper\Contract\VersionDocumentLink"
      "actionLink" => "Project\View\Helper\Action\ActionLink"
      "actionTypeLink" => "Project\View\Helper\Action\TypeLink"
      "awardLink" => "Project\View\Helper\Award\AwardLink"
      "awardTypeLink" => "Project\View\Helper\Award\TypeLink"
      "eventLink" => "Project\View\Helper\EventLink"
      "eventTypeLink" => "Project\View\Helper\EventTypeLink"
      "projectformelement" => "Project\Form\View\Helper\ProjectFormElement"
      "resultselect" => "Project\Form\View\Helper\ResultSelect"
      "feedbackLink" => "Evaluation\View\Helper\FeedbackLink"
      "evaluationLink" => "Evaluation\View\Helper\EvaluationLink"
      "evaluationReportLink" => "Evaluation\View\Helper\ReportLink"
      "evaluationReportDownloadLink" => "Evaluation\View\Helper\Report\DownloadLink"
      "evaluationReportPresentationLink" => "Evaluation\View\Helper\Report\PresentationLink"
      "evaluationReportFinalLink" => "Evaluation\View\Helper\Report\FinalLink"
      "evaluationReportProgress" => "Evaluation\View\Helper\Report\Progress"
      "evaluationReportScore" => "Evaluation\View\Helper\Report\Score"
      "reportVersionLink" => "Evaluation\View\Helper\Report\VersionLink"
      "reportWindowLink" => "Evaluation\View\Helper\Report\WindowLink"
      "reportCriterionLink" => "Evaluation\View\Helper\Report\CriterionLink"
      "reportCriterionCategoryLink" => "Evaluation\View\Helper\Report\Criterion\CategoryLink"
      "reportCriterionTypeLink" => "Evaluation\View\Helper\Report\Criterion\TypeLink"
      "reportCriterionTopicLink" => "Evaluation\View\Helper\Report\Criterion\TopicLink"
      "reportCriterionVersionLink" => "Evaluation\View\Helper\Report\Criterion\VersionLink"
      "reviewerLink" => "Evaluation\View\Helper\ReviewerLink"
      "reviewerContactLink" => "Evaluation\View\Helper\Reviewer\ContactLink"
      "pressArticleLink" => "Press\View\Helper\ArticleLink"
      "bureauLink" => "Press\View\Helper\BureauLink"
      "programHandler" => "Program\View\Handler\ProgramHandler"
      "callInformationBox" => "Program\View\Helper\CallInformationBox"
      "programLink" => "Program\View\Helper\ProgramLink"
      "programDoaLink" => "Program\View\Helper\DoaLink"
      "callLink" => "Program\View\Helper\CallLink"
      "ndaLink" => "Program\View\Helper\NdaLink"
      "funderLink" => "Program\View\Helper\FunderLink"
      "callCountryLink" => "Program\View\Helper\CallCountryLink"
      "accessLink" => "Admin\View\Helper\AccessLink"
      "permitEntityLink" => "Admin\View\Helper\Permit\EntityLink"
      "permitRoleLink" => "Admin\View\Helper\Permit\RoleLink"
      "permitSetterLink" => "Admin\View\Helper\Permit\SetterLink"
      "queueLink" => "Admin\View\Helper\QueueLink"
      "oauth2clientlink" => "Admin\View\Helper\OAuth2\ClientLink"
      "oauth2scopelink" => "Admin\View\Helper\OAuth2\ScopeLink"
      "apiLogLink" => "Admin\View\Helper\Api\LogLink"
      "accessformelement" => "Admin\Form\View\Helper\AccessFormElement"
      "ztbalert" => "lbs5alert"
      "ztbformelement" => "lbs5formelement"
      "filterbarelement" => "lbs5filterbarelement"
      "lbs5navigation" => "LaminasBootstrap5\View\Helper\Navigation"
      "lbs5filterbarelement" => "LaminasBootstrap5\Form\View\Helper\FilterBarElement"
      "lbs5filtercolumnelement" => "LaminasBootstrap5\Form\View\Helper\FilterColumnElement"
      "lbs5formelement" => "LaminasBootstrap5\Form\View\Helper\FormElement"
      "lbs5formcheckbox" => "LaminasBootstrap5\Form\View\Helper\FormCheckbox"
      "associateLink" => "Affiliation\View\Helper\AssociateLink"
      "affiliationLink" => "Affiliation\View\Helper\AffiliationLink"
      "affiliationDoaLink" => "Affiliation\View\Helper\DoaLink"
      "affiliationLoiLink" => "Affiliation\View\Helper\LoiLink"
      "paymentSheet" => "Affiliation\View\Helper\PaymentSheet"
      "affiliationEffortSpentLink" => "Affiliation\View\Helper\EffortSpentLink"
      "affiliationQuestionCategoryLink" => "Affiliation\View\Helper\Questionnaire\CategoryLink"
      "affiliationQuestionLink" => "Affiliation\View\Helper\Questionnaire\QuestionLink"
      "affiliationQuestionnaireLink" => "Affiliation\View\Helper\Questionnaire\QuestionnaireLink"
      "questionnaireHelper" => "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper"
      "organisationLink" => "Organisation\View\Helper\OrganisationLink"
      "organisationTypeLink" => "Organisation\View\Helper\Organisation\TypeLink"
      "organisationLogo" => "Organisation\View\Helper\OrganisationLogo"
      "organisationNoteLink" => "Organisation\View\Helper\NoteLink"
      "boardLink" => "Organisation\View\Helper\BoardLink"
      "organisationSelectionLink" => "Organisation\View\Helper\SelectionLink"
      "parentLink" => "Organisation\View\Helper\Parent\ParentLink"
      "parentOrganisationLink" => "Organisation\View\Helper\Parent\OrganisationLink"
      "parentDoaLink" => "Organisation\View\Helper\Parent\DoaLink"
      "parentTypeLink" => "Organisation\View\Helper\Parent\TypeLink"
      "parentFinancialLink" => "Organisation\View\Helper\Parent\FinancialLink"
      "advisoryBoardCityLink" => "Organisation\View\Helper\AdvisoryBoard\CityLink"
      "advisoryBoardCityImage" => "Organisation\View\Helper\AdvisoryBoard\CityImage"
      "advisoryBoardSolutionLink" => "Organisation\View\Helper\AdvisoryBoard\SolutionLink"
      "advisoryBoardSolutionImage" => "Organisation\View\Helper\AdvisoryBoard\SolutionImage"
      "organisationUpdateLink" => "Organisation\View\Helper\UpdateLink"
      "organisationUpdateLogo" => "Organisation\View\Helper\UpdateLogo"
      "organisationUpdateNotification" => "Organisation\View\Helper\UpdateNotification"
      "overviewVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution"
      "overviewExtraVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution"
      "organisationselect" => "Organisation\Form\View\Helper\OrganisationFormElement"
      "parentformelement" => "Organisation\Form\View\Helper\ParentFormElement"
      "publicationLink" => "Publication\View\Helper\PublicationLink"
      "publicationTypeLink" => "Publication\View\Helper\TypeLink"
      "publicationCategoryLink" => "Publication\View\Helper\CategoryLink"
      "invoiceLink" => "Invoice\View\Helper\InvoiceLink"
      "transactionLink" => "Invoice\View\Helper\TransactionLink"
      "invoiceRowLink" => "Invoice\View\Helper\RowLink"
      "dimensionLink" => "Invoice\View\Helper\DimensionLink"
      "invoicePdfLink" => "Invoice\View\Helper\PdfLink"
      "invoiceWordLink" => "Invoice\View\Helper\WordLink"
      "reminderLink" => "Invoice\View\Helper\ReminderLink"
      "reminderInvoiceOverview" => "Invoice\View\Helper\ReminderInvoiceOverview"
      "journalLink" => "Invoice\View\Helper\JournalLink"
      "dailyUpdateHandler" => "Invoice\View\Helper\DailyUpdateHandler"
      "canAssemble" => "Deeplink\View\Helper\CanAssemble"
      "deeplinkLink" => "Deeplink\View\Helper\DeeplinkLink"
      "deeplinkTargetLink" => "Deeplink\View\Helper\Deeplink\TargetLink"
      "deskCostsLink" => "Event\View\Helper\DeskCostsLink"
      "meetingLink" => "Event\View\Helper\Meeting\MeetingLink"
      "meetingOptionLink" => "Event\View\Helper\Meeting\OptionLink"
      "meetingOptionCostLink" => "Event\View\Helper\Meeting\OptionCostLink"
      "meetingCostLink" => "Event\View\Helper\Meeting\CostLink"
      "meetingQuotaLink" => "Event\View\Helper\Meeting\QuotaLink"
      "meetingCouponLink" => "Event\View\Helper\CouponLink"
      "boothLink" => "Event\View\Helper\Booth\BoothLink"
      "boothSpecLink" => "Event\View\Helper\Booth\SpecLink"
      "exhibitionLink" => "Event\View\Helper\Exhibition\ExhibitionLink"
      "registrationLink" => "Event\View\Helper\RegistrationLink"
      "meetingFloorplanLink" => "Event\View\Helper\Meeting\FloorplanLink"
      "exhibitionSpecLink" => "Event\View\Helper\Exhibition\SpecLink"
      "exhibitionCostLink" => "Event\View\Helper\Exhibition\CostLink"
      "badgeLink" => "Event\View\Helper\Badge\BadgeLink"
      "badgeAttachmentLink" => "Event\View\Helper\Badge\AttachmentLink"
      "badgeImage" => "Event\View\Helper\Badge\Image"
      "badgeContactLink" => "Event\View\Helper\Badge\ContactLink"
      "ticketImage" => "Event\View\Helper\Ticket\Image"
      "ticketLink" => "Event\View\Helper\Ticket\TicketLink"
      "calendarDocumentLink" => "Calendar\View\Helper\DocumentLink"
      "calendarTypeLink" => "Calendar\View\Helper\TypeLink"
      "calendarLink" => "Calendar\View\Helper\CalendarLink"
      "mailingLink" => "Mailing\View\Helper\MailingLink"
      "attachmentLink" => "Mailing\View\Helper\AttachmentLink"
      "mailingContactLink" => "Mailing\View\Helper\MailingContactLink"
      "mailingTemplateLink" => "Mailing\View\Helper\TemplateLink"
      "senderLink" => "Mailing\View\Helper\SenderLink"
      "emailMessageEventIcon" => "Mailing\View\Helper\EmailMessageEventIcon"
    ]
    "factories" => array:348 [
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\ApiTools\Documentation\View\AgAcceptHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgServicePath" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgStatusCodes" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgTransformDescription" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Hal" => "Laminas\ApiTools\Hal\Factory\HalViewHelperFactory"
      "AssetManager\View\Helper\Asset" => "AssetManager\Service\AssetViewHelperFactory"
      "isAllowed" => "BjyAuthorize\View\Helper\IsAllowedFactory"
      "Content\View\Helper\NodeLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ParamLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\HandlerLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\SegmentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TemplateLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ContentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\RouteLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TopicLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Image" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Video" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\NodeTableRow" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ImageHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ArticleHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ContentHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\PaginationLink" => "Application\Factory\InvokableFactory"
      "Content\View\Helper\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\ChallengeIcon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\ChallengeImage" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Image" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Icon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Country\CountryFlag" => "General\View\Factory\ImageHelperFactory"
      "General\View\Handler\CountryHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ImpactStreamHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ChallengeHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Challenge\ChallengeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\CurrencyLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ExchangeRateLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\PasswordLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LanguageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\GenderLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\EmailMessageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\TitleLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\WebInfoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ContentTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryMap" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\ContentTypeIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\View\Helper\ClusterLink" => "General\View\Factory\LinkHelperFactory"
      "Cluster\View\Helper\Cluster\Logo" => "General\View\Factory\ImageHelperFactory"
      "News\View\Handler\NewsHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\BlogHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\MagazineHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Helper\BlogLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\TagLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\NewsLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\News\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\MagazineLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Magazine\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\DndLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ProfileLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Selection\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\FacebookLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\OptInLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\AddressLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\NoteLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\PhoneLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactPhoto" => "General\View\Factory\ImageHelperFactory"
      "Contact\View\Helper\Office\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Office\LeaveLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\Form\View\Helper\ContactFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\View\Helper\SelectionFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusBadge" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Quality\View\Helper\PhaseLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\YearLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\KpiLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\Action\SourceLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\View\Helper\ProjectFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ProjectHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ResultHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\IdeaHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectLogo" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Project\Quickstart" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\StatusIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectDates" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaImage" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PcaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpFaqLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\VersionLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Version\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportHelper" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Report\ItemLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\Window\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WorkpackageDescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\WorkpackageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\TaskLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DeliverableLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\FeeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ToolLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PartnerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Description\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MeetingLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Meeting\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Message\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Status\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Poster\Attachment" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Poster\Thumbnail" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Tool\SessionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\BuildHelp" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Description\BuildTree" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildContent" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\RationaleLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\AchievementLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\LinkLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CostChangeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\CalendarReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\ContractLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionDocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\AwardLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventTypeLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\FeedbackLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\EvaluationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\DownloadLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\PresentationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\FinalLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Progress" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\Score" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\CriterionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Criterion\CategoryLink" => "General\View\Factory\LinkHelperFactory"
       …109
    ]
    "invokables" => array:18 [ …18]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:2 [ …2]
  ]
  "controller_plugins" => array:3 [
    "aliases" => array:100 [ …100]
    "factories" => array:89 [ …89]
    "invokables" => array:2 [ …2]
  ]
  "asset_manager" => array:6 [
    "resolver_configs" => array:4 [ …4]
    "clear_output_buffer" => true
    "resolvers" => array:6 [ …6]
    "view_helper" => array:3 [ …3]
    "caching" => array:4 [ …4]
    "filters" => array:2 [ …2]
  ]
  "api-tools" => array:1 [
    "db-connected" => []
  ]
  "controllers" => array:4 [
    "aliases" => array:3 [ …3]
    "factories" => array:330 [ …330]
    "abstract_factories" => array:2 [ …2]
    "invokables" => array:3 [ …3]
  ]
  "api-tools-content-negotiation" => array:6 [
    "controllers" => array:2 [ …2]
    "accept_whitelist" => array:1 [ …1]
    "selectors" => array:3 [ …3]
    "content_type_whitelist" => []
    "x_http_method_override_enabled" => false
    "http_override_methods" => []
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:5 [ …5]
    "display_exceptions" => true
    "template_map" => array:1497 [ …1497]
    "strategies" => array:2 [ …2]
    "display_not_found_reason" => true
    "doctype" => "HTML5"
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
  ]
  "api-tools-api-problem" => []
  "api-tools-configuration" => array:1 [
    "config_file" => "config/autoload/development.php"
  ]
  "api-tools-oauth2" => array:7 [
    "grant_types" => array:5 [ …5]
    "api_problem_error_response" => true
    "storage" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
    "options" => array:6 [ …6]
    "allow_implicit" => true
    "access_lifetime" => 3600
    "enforce_state" => true
  ]
  "api-tools-mvc-auth" => array:2 [
    "authentication" => array:2 [ …2]
    "authorization" => array:2 [ …2]
  ]
  "api-tools-hal" => array:3 [
    "renderer" => []
    "metadata_map" => []
    "options" => array:1 [ …1]
  ]
  "filters" => array:1 [
    "factories" => array:2 [ …2]
  ]
  "validators" => array:2 [
    "factories" => array:8 [ …8]
    "aliases" => array:3 [ …3]
  ]
  "input_filter_specs" => []
  "api-tools-content-validation" => array:1 [
    "methods_without_bodies" => []
  ]
  "api-tools-rest" => array:1 [
    "Api\V1\Rest\ContactResource\MeListener" => array:11 [ …11]
  ]
  "api-tools-rpc" => []
  "api-tools-versioning" => array:3 [
    "content-type" => []
    "default_version" => 1
    "uri" => []
  ]
  "bjyauthorize" => array:12 [
    "guards" => array:1 [ …1]
    "default_role" => "guest"
    "authenticated_role" => "user"
    "identity_provider" => "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider"
    "role_providers" => array:1 [ …1]
    "resource_providers" => []
    "rule_providers" => []
    "unauthorized_strategy" => "Jield\Authorize\View\UnauthorizedStrategy"
    "template" => "error/403"
    "cache_enabled" => true
    "cache_options" => array:2 [ …2]
    "cache_key" => "bjyauthorize_acl"
  ]
  "doctrine" => array:15 [
    "driver" => array:22 [ …22]
    "cache" => array:11 [ …11]
    "authentication" => array:2 [ …2]
    "authenticationadapter" => array:2 [ …2]
    "authenticationstorage" => array:2 [ …2]
    "authenticationservice" => array:2 [ …2]
    "connection" => array:1 [ …1]
    "configuration" => array:1 [ …1]
    "entitymanager" => array:1 [ …1]
    "eventmanager" => array:1 [ …1]
    "sql_logger_collector" => array:1 [ …1]
    "mapping_collector" => array:1 [ …1]
    "entity_resolver" => array:1 [ …1]
    "migrations_configuration" => array:1 [ …1]
    "migrations_cmd" => array:13 [ …13]
  ]
  "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory" => array:608 [
    "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
    "Jield\Authorize\View\UnauthorizedStrategy" => array:2 [ …2]
    "Application\Twig\DatabaseTwigLoader" => array:1 [ …1]
    "Application\Event\SetTitle" => array:2 [ …2]
    "Application\Event\InjectAclInNavigation" => array:2 [ …2]
    "Application\Event\BlockInactiveContact" => array:1 [ …1]
    "Application\Event\RegisterPageview" => array:3 [ …3]
    "Application\Authentication\Storage\AuthenticationStorage" => array:2 [ …2]
    "Laminas\Authentication\AuthenticationService" => array:1 [ …1]
    "Application\Session\SaveHandler\DoctrineGateway" => array:2 [ …2]
    "Content\Controller\Json\ArticleController" => array:1 [ …1]
    "Content\Controller\Json\ImageController" => array:3 [ …3]
    "Content\Controller\Json\NodeController" => array:3 [ …3]
    "Content\Controller\ArticleController" => array:4 [ …4]
    "Content\Controller\ContentController" => array:1 [ …1]
    "Content\Controller\ImageController" => array:4 [ …4]
    "Content\Controller\VideoController" => array:4 [ …4]
    "Content\Controller\NodeController" => array:3 [ …3]
    "Content\Controller\NodeManagerController" => array:4 [ …4]
    "Content\Controller\RedirectController" => array:3 [ …3]
    "Content\Navigation\Service\ContentNavigationService" => array:7 [ …7]
    "Content\InputFilter\HandlerFilter" => array:1 [ …1]
    "Content\InputFilter\RouteFilter" => array:1 [ …1]
    "Content\InputFilter\SegmentFilter" => array:1 [ …1]
    "Content\InputFilter\TemplateFilter" => array:1 [ …1]
    "Content\InputFilter\TopicFilter" => array:1 [ …1]
    "Content\Service\ArticleService" => array:1 [ …1]
    "Content\Service\VimeoService" => array:2 [ …2]
    "Content\Service\RouteService" => array:1 [ …1]
    "Content\Service\ContentService" => array:1 [ …1]
    "Content\Service\NodeService" => array:2 [ …2]
    "Content\View\Helper\BuildNavigation" => array:3 [ …3]
    "Content\View\Helper\NodeTableRow" => array:2 [ …2]
    "Content\View\Helper\Image" => array:3 [ …3]
    "Content\View\Handler\ArticleHandler" => array:8 [ …8]
    "Content\View\Handler\ContentHandler" => array:8 [ …8]
    "Content\View\Handler\ImageHandler" => array:8 [ …8]
    "General\Controller\ChallengeController" => array:4 [ …4]
    "General\Controller\ChallengeTypeController" => array:3 [ …3]
    "General\Controller\ContentTypeController" => array:3 [ …3]
    "General\Controller\LanguageController" => array:3 [ …3]
    "General\Controller\CountryController" => array:4 [ …4]
    "General\Controller\Country\VideoController" => array:3 [ …3]
    "General\Controller\CurrencyController" => array:3 [ …3]
    "General\Controller\EmailController" => array:2 [ …2]
    "General\Controller\ExchangeRateController" => array:3 [ …3]
    "General\Controller\GenderController" => array:3 [ …3]
    "General\Controller\ImageController" => array:2 [ …2]
    "General\Controller\ImpactStreamController" => array:3 [ …3]
    "General\Controller\LogController" => array:3 [ …3]
    "General\Controller\PasswordController" => array:3 [ …3]
    "General\Controller\TitleController" => array:3 [ …3]
    "General\Controller\VatController" => array:3 [ …3]
    "General\Controller\VatTypeController" => array:3 [ …3]
    "General\Controller\WebInfoController" => array:4 [ …4]
    "General\Service\GeneralService" => array:1 [ …1]
    "General\Service\CountryService" => array:3 [ …3]
    "General\View\Handler\ImpactStreamHandler" => array:9 [ …9]
    "General\View\Handler\ChallengeHandler" => array:7 [ …7]
    "General\View\Handler\CountryHandler" => array:9 [ …9]
    "General\View\Helper\ContentTypeIcon" => array:1 [ …1]
    "General\View\Helper\Country\CountryMap" => array:2 [ …2]
    "General\Search\Service\CountrySearchService" => array:1 [ …1]
    "Cluster\Command\UpdateProject" => array:4 [ …4]
    "Cluster\Command\GenerateProjectJson" => array:2 [ …2]
    "Cluster\Controller\Admin\ClusterController" => array:4 [ …4]
    "Cluster\Controller\ImageController" => array:1 [ …1]
    "Cluster\Service\ClusterService" => array:1 [ …1]
    "Cluster\Service\StatisticsService" => array:1 [ …1]
    "Cluster\Form\ClusterForm" => array:1 [ …1]
    "News\Controller\BlogController" => array:4 [ …4]
    "News\Controller\Blog\CategoryController" => array:3 [ …3]
    "News\Controller\Blog\TagController" => array:3 [ …3]
    "News\Controller\Blog\MessageController" => array:3 [ …3]
    "News\Controller\NewsController" => array:4 [ …4]
    "News\Controller\News\CategoryController" => array:3 [ …3]
    "News\Controller\MagazineController" => array:4 [ …4]
    "News\Controller\Magazine\ArticleController" => array:4 [ …4]
    "News\Service\BlogService" => array:4 [ …4]
    "News\Service\NewsService" => array:3 [ …3]
    "News\Service\MagazineService" => array:1 [ …1]
    "News\Search\Service\NewsSearchService" => array:1 [ …1]
    "News\Search\Service\BlogSearchService" => array:1 [ …1]
    "News\View\Handler\NewsHandler" => array:7 [ …7]
    "News\View\Handler\BlogHandler" => array:7 [ …7]
    "News\View\Handler\MagazineHandler" => array:6 [ …6]
    "Contact\Controller\AddressManagerController" => array:3 [ …3]
    "Contact\Controller\ContactAdminController" => array:12 [ …12]
    "Contact\Controller\ContactDetailsController" => array:10 [ …10]
    "Contact\Controller\ContactController" => array:3 [ …3]
    "Contact\Controller\DndController" => array:5 [ …5]
    "Contact\Controller\FacebookController" => array:3 [ …3]
    "Contact\Controller\FacebookManagerController" => array:3 [ …3]
    "Contact\Controller\OptInManagerController" => array:3 [ …3]
    "Contact\Controller\ImageController" => array:1 [ …1]
    "Contact\Controller\NoteManagerController" => array:3 [ …3]
    "Contact\Controller\PhoneManagerController" => array:3 [ …3]
    "Contact\Controller\ProfileController" => array:10 [ …10]
    "Contact\Controller\Selection\ManagerController" => array:7 [ …7]
    "Contact\Controller\Selection\TypeController" => array:3 [ …3]
    "Contact\Controller\Office\ContactController" => array:2 [ …2]
    "Contact\Controller\Office\LeaveController" => array:3 [ …3]
    "Contact\Command\Cleanup" => array:1 [ …1]
    "Contact\Command\ResetAccess" => array:1 [ …1]
    "Contact\Provider\ContactProvider" => array:1 [ …1]
    "Contact\Controller\Plugin\MergeContact" => array:3 [ …3]
    "Contact\Controller\Plugin\ContactActions" => array:3 [ …3]
    "Contact\Controller\Plugin\HandleImport" => array:6 [ …6]
    "Contact\Controller\Plugin\SelectionExport" => array:4 [ …4]
    "Contact\Search\Service\ContactSearchService" => array:1 [ …1]
    "Contact\Search\Service\ProfileSearchService" => array:1 [ …1]
    "Contact\Form\ContactForm" => array:1 [ …1]
    "Contact\Form\View\Helper\ContactFormElement" => array:3 [ …3]
    "Contact\Form\View\Helper\SelectionFormElement" => array:2 [ …2]
    "Contact\Service\AddressService" => array:1 [ …1]
    "Contact\Service\ContactService" => array:9 [ …9]
    "Contact\Service\SelectionContactService" => array:1 [ …1]
    "Contact\Service\SelectionService" => array:3 [ …3]
    "Contact\Service\Office\ContactService" => array:1 [ …1]
    "Quality\Controller\IndexController" => array:1 [ …1]
    "Quality\Controller\ProcessController" => array:2 [ …2]
    "Quality\Controller\PhaseController" => array:2 [ …2]
    "Quality\Controller\StatusController" => array:2 [ …2]
    "Quality\Controller\YearController" => array:2 [ …2]
    "Quality\Controller\ActionController" => array:2 [ …2]
    "Quality\Controller\TargetController" => array:2 [ …2]
    "Quality\Controller\KpiController" => array:2 [ …2]
    "Quality\Controller\Kpi\TargetController" => array:2 [ …2]
    "Quality\Controller\Kpi\GroupController" => array:2 [ …2]
    "Quality\Controller\Kpi\ResultController" => array:2 [ …2]
    "Quality\Controller\Kpi\Result\MatrixController" => array:1 [ …1]
    "Quality\Controller\Kpi\ActionController" => array:1 [ …1]
    "Quality\Controller\Action\SourceController" => array:2 [ …2]
    "Quality\Controller\Action\GroupController" => array:2 [ …2]
    "Quality\Controller\Action\ResultController" => array:2 [ …2]
    "Quality\Controller\Action\Result\MatrixController" => array:2 [ …2]
    "Quality\Service\QualityService" => array:2 [ …2]
    "Quality\View\Helper\Kpi\Result\Matrix" => array:2 [ …2]
    "Quality\View\Helper\Action\Result\Matrix" => array:2 [ …2]
    "Project\Controller\Json\AchievementController" => array:1 [ …1]
    "Project\Controller\Json\Achievement\ExploitableResultController" => array:1 [ …1]
    "Project\Controller\Json\ContractController" => array:3 [ …3]
    "Project\Controller\Json\CostController" => array:5 [ …5]
    "Project\Controller\Json\DescriptionController" => array:1 [ …1]
    "Project\Controller\Json\EffortController" => array:6 [ …6]
    "Project\Controller\Json\FundingController" => array:3 [ …3]
    "Project\Controller\Json\FundingStatusController" => array:2 [ …2]
    "Project\Controller\Json\HelpController" => array:1 [ …1]
    "Project\Controller\Json\IdeaController" => array:1 [ …1]
    "Project\Controller\Json\Idea\ToolController" => array:2 [ …2]
    "Project\Controller\Json\Idea\PosterController" => array:2 [ …2]
    "Project\Controller\Json\InviteController" => array:6 [ …6]
    "Project\Controller\Json\ReportController" => array:1 [ …1]
    "Project\Controller\Json\ResultController" => array:1 [ …1]
    "Project\Controller\Json\WorkpackageController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\TaskController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\DeliverableController" => array:3 [ …3]
    "Project\Controller\Action\TypeController" => array:3 [ …3]
    "Project\Controller\Action\ActionController" => array:10 [ …10]
    "Project\Controller\Event\TypeController" => array:3 [ …3]
    "Project\Controller\SelectionController" => array:4 [ …4]
    "Project\Controller\Event\EventController" => array:5 [ …5]
    "Project\Controller\ChangeRequest\ChangeRequestController" => array:7 [ …7]
    "Project\Controller\ChangeRequest\ProcessController" => array:9 [ …9]
    "Project\Controller\ChangeRequest\UpdateController" => array:14 [ …14]
    "Project\Controller\ChangeRequest\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\Admin\DetailsController" => array:3 [ …3]
    "Project\Controller\Idea\PosterManagerController" => array:5 [ …5]
    "Project\Controller\Idea\PosterController" => array:1 [ …1]
    "Project\Controller\Achievement\AchievementController" => array:6 [ …6]
    "Project\Controller\Achievement\ExploitableResultController" => array:6 [ …6]
    "Project\Controller\Achievement\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\TypeController" => array:2 [ …2]
    "Project\Controller\Achievement\CategoryController" => array:4 [ …4]
    "Project\Controller\Achievement\ExploitableResult\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\ExploitableResult\LinkController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Link\ManagerController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\DocumentController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Document\ManagerController" => array:3 [ …3]
    "Project\Controller\Award\AwardController" => array:3 [ …3]
    "Project\Controller\Award\TypeController" => array:2 [ …2]
    "Project\Controller\Contract\ContractController" => array:6 [ …6]
    "Project\Controller\Contract\DocumentController" => array:1 [ …1]
    "Project\Controller\Contract\VersionController" => array:3 [ …3]
    "Project\Controller\CommunityController" => array:21 [ …21]
    "Project\Controller\Rationale\RationaleController" => array:10 [ …10]
    "Project\Controller\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\DocumentController" => array:5 [ …5]
    "Project\Controller\Document\TypeController" => array:2 [ …2]
    "Project\Controller\EditController" => array:14 [ …14]
    "Project\Controller\FeeManagerController" => array:2 [ …2]
    "Project\Controller\HelpController" => array:3 [ …3]
    "Project\Controller\EventManagerController" => array:4 [ …4]
    "Project\Controller\HelpManagerController" => array:3 [ …3]
    "Project\Controller\ImageController" => array:1 [ …1]
    "Project\Controller\Idea\IdeaController" => array:13 [ …13]
    "Project\Controller\Idea\InviteController" => array:3 [ …3]
    "Project\Controller\Idea\DescriptionController" => array:2 [ …2]
    "Project\Controller\Idea\Description\TypeController" => array:2 [ …2]
    "Project\Controller\Idea\ToolController" => array:1 [ …1]
    "Project\Controller\Idea\ToolManagerController" => array:4 [ …4]
    "Project\Controller\Idea\Tool\Session\ManagerController" => array:5 [ …5]
    "Project\Controller\Idea\Tool\SessionController" => array:2 [ …2]
    "Project\Controller\Idea\PartnerController" => array:3 [ …3]
    "Project\Controller\Idea\DocumentController" => array:2 [ …2]
    "Project\Controller\Idea\ImageController" => array:2 [ …2]
    "Project\Controller\Idea\VideoController" => array:3 [ …3]
    "Project\Controller\Idea\MeetingController" => array:4 [ …4]
    "Project\Controller\Idea\MeetingManagerController" => array:3 [ …3]
    "Project\Controller\Idea\Meeting\InviteController" => array:5 [ …5]
    "Project\Controller\Idea\MessageController" => array:3 [ …3]
    "Project\Controller\Idea\Message\DocumentController" => array:1 [ …1]
    "Project\Controller\Idea\StatusController" => array:3 [ …3]
    "Project\Controller\Idea\Status\DocumentController" => array:1 [ …1]
    "Project\Controller\InviteController" => array:6 [ …6]
    "Project\Controller\PcaController" => array:3 [ …3]
    "Project\Controller\PcaManagerController" => array:5 [ …5]
    "Project\Controller\LogManagerController" => array:5 [ …5]
    "Project\Controller\Project\AdminController" => array:23 [ …23]
    "Project\Controller\Project\CalendarManagerController" => array:3 [ …3]
    "Project\Controller\Project\ProjectController" => array:2 [ …2]
    "Project\Controller\Project\DetailsController" => array:24 [ …24]
    "Project\Controller\Project\ExportController" => array:1 [ …1]
    "Project\Controller\Project\ManagerController" => array:8 [ …8]
    "Project\Controller\Rationale\ManagerController" => array:4 [ …4]
    "Project\Controller\Report\ReportController" => array:6 [ …6]
    "Project\Controller\Report\DetailsController" => array:11 [ …11]
    "Project\Controller\Report\ItemController" => array:3 [ …3]
    "Project\Controller\Report\ManagerController" => array:10 [ …10]
    "Project\Controller\Report\WindowController" => array:3 [ …3]
    "Project\Controller\Report\Window\ProjectController" => array:2 [ …2]
    "Project\Controller\Result\CategoryController" => array:2 [ …2]
    "Project\Controller\Result\ManagerController" => array:6 [ …6]
    "Project\Controller\Result\TypeController" => array:2 [ …2]
    "Project\Controller\RoadmapController" => array:5 [ …5]
    "Project\Controller\Version\VersionController" => array:11 [ …11]
    "Project\Controller\Version\DocumentController" => array:5 [ …5]
    "Project\Controller\Version\Document\ManagerController" => array:6 [ …6]
    "Project\Controller\Version\ManagerController" => array:15 [ …15]
    "Project\Controller\Version\TypeController" => array:3 [ …3]
    "Project\Controller\Workpackage\WorkpackageController" => array:7 [ …7]
    "Project\Controller\Workpackage\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\DocumentManagerController" => array:5 [ …5]
    "Project\Controller\Workpackage\Deliverable\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\Deliverable\DocumentManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\ManagerController" => array:6 [ …6]
    "Project\Controller\Workpackage\Deliverable\TypeController" => array:3 [ …3]
    "Project\Controller\StatisticsController" => array:1 [ …1]
    "Project\Provider\ProjectProvider" => array:6 [ …6]
    "Project\Provider\Version\VersionProvider" => array:3 [ …3]
    "Project\Job\CometChat\CreateIdeaGroup" => array:4 [ …4]
    "Project\Job\CometChat\UpdateMembersOfIdeaGroup" => array:4 [ …4]
    "Project\Controller\Plugin\CreateExport" => array:4 [ …4]
    "Project\Controller\Plugin\SelectionExport" => array:5 [ …5]
    "Project\Controller\Plugin\Merge\CreateMergedDocument" => array:12 [ …12]
    "Project\Controller\Plugin\Merge\CreateSummaryDocument" => array:4 [ …4]
    "Project\Controller\Plugin\Merge\CreateMergedProjectReport" => array:13 [ …13]
    "Project\Controller\Plugin\Merge\CreateMergedChangeRequestDocument" => array:7 [ …7]
    "Project\Controller\Plugin\CreateVersion" => array:7 [ …7]
    "Project\Controller\Plugin\Checklist\ProjectChecklist" => array:8 [ …8]
    "Project\Controller\Plugin\Checklist\ReportChecklist" => array:5 [ …5]
    "Project\Controller\Plugin\Changes\ProjectChanges" => array:5 [ …5]
    "Project\Controller\Plugin\Checklist\ChangeRequestChecklist" => array:7 [ …7]
    "Project\Controller\Plugin\RenderReportWorkpackageDescriptions" => array:2 [ …2]
    "Project\Controller\Plugin\RenderVersionStatistics" => array:7 [ …7]
    "Project\Controller\Plugin\Achievement\Export" => array:2 [ …2]
    "Project\Controller\Plugin\Achievement\Import" => array:2 [ …2]
    "Project\Controller\Plugin\ActionExport" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\IdeasPerCountryDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Invite\Accept" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Accept" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Export" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionPdf" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionSpreadsheet" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Poster\PosterPdf" => array:3 [ …3]
    "Project\InputFilter\RationaleFilter" => array:1 [ …1]
    "Project\Form\ProjectForm" => array:1 [ …1]
    "Project\Service\ProjectService" => array:9 [ …9]
    "Project\Service\ActionService" => array:5 [ …5]
    "Project\Service\VersionService" => array:3 [ …3]
    "Project\Service\WorkpackageService" => array:4 [ …4]
    "Project\Service\IdeaService" => array:12 [ …12]
    "Project\Service\Idea\MeetingService" => array:2 [ …2]
    "Project\Service\Idea\Tool\SessionService" => array:2 [ …2]
    "Project\Service\DescriptionService" => array:3 [ …3]
    "Project\Service\ResultService" => array:4 [ …4]
    "Project\Service\VersionDocumentService" => array:4 [ …4]
    "Project\Service\EventService" => array:2 [ …2]
    "Project\Service\HelpService" => array:2 [ …2]
    "Project\Service\KeywordService" => array:1 [ …1]
    "Project\Service\AchievementService" => array:4 [ …4]
    "Project\Service\Achievement\ExploitableResultService" => array:4 [ …4]
    "Project\Service\ReportService" => array:2 [ …2]
    "Project\Service\DocumentService" => array:1 [ …1]
    "Project\Service\ContractService" => array:2 [ …2]
    "Project\Service\InviteService" => array:6 [ …6]
    "Project\Service\SelectionService" => array:1 [ …1]
    "Project\Service\AwardService" => array:1 [ …1]
    "Project\Service\ChangeRequestService" => array:7 [ …7]
    "Project\Service\Report\WindowService" => array:1 [ …1]
    "Project\Search\Service\AchievementSearchService" => array:1 [ …1]
    "Project\Search\Service\Achievement\ExploitableResultSearchService" => array:1 [ …1]
    "Project\Search\Service\IdeaSearchService" => array:1 [ …1]
    "Project\Search\Service\DescriptionSearchService" => array:1 [ …1]
    "Project\Search\Service\ProjectSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\WorkpackageDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\ResultSearchService" => array:1 [ …1]
    "Project\Search\Service\ActionSearchService" => array:1 [ …1]
    "Project\View\Handler\ProjectHandler" => array:16 [ …16]
    "Project\View\Handler\ResultHandler" => array:8 [ …8]
    "Project\View\Handler\IdeaHandler" => array:11 [ …11]
    "Project\View\Helper\Project\StatusIcon" => array:1 [ …1]
    "Project\View\Helper\Project\ProjectDates" => array:3 [ …3]
    "Project\View\Helper\Description\BuildContent" => array:1 [ …1]
    "Project\View\Helper\Description\BuildNavigation" => array:2 [ …2]
    "Project\View\Helper\Description\BuildTree" => array:2 [ …2]
    "Project\View\Helper\Project\Quickstart" => array:2 [ …2]
    "Project\View\Helper\BuildHelp" => array:3 [ …3]
    "Project\View\Helper\Version\VersionLink" => array:6 [ …6]
    "Project\View\Helper\HelpLink" => array:6 [ …6]
    "Project\View\Helper\Report\ReportHelper" => array:1 [ …1]
    "Project\Form\View\Helper\ProjectFormElement" => array:2 [ …2]
    "Evaluation\Controller\ReportController" => array:4 [ …4]
    "Evaluation\Controller\FeedbackController" => array:4 [ …4]
    "Evaluation\Controller\EvaluationController" => array:10 [ …10]
    "Evaluation\Controller\EvaluationManagerController" => array:4 [ …4]
    "Evaluation\Controller\ReportManagerController" => array:5 [ …5]
    "Evaluation\Controller\Report\CriterionController" => array:4 [ …4]
    "Evaluation\Controller\Report\VersionController" => array:4 [ …4]
    "Evaluation\Controller\Report\WindowController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\CategoryController" => array:2 [ …2]
    "Evaluation\Controller\Report\Criterion\TypeController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\TopicController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\VersionController" => array:3 [ …3]
    "Evaluation\Controller\ReviewerManagerController" => array:5 [ …5]
    "Evaluation\Controller\ReviewScheduleController" => array:5 [ …5]
    "Evaluation\Controller\Reviewer\ContactManagerController" => array:2 [ …2]
    "Evaluation\Controller\JsonController" => array:3 [ …3]
    "Evaluation\Controller\Plugin\CreateEvaluation" => array:5 [ …5]
    "Evaluation\Controller\Plugin\RosterGenerator" => array:3 [ …3]
    "Evaluation\Controller\Plugin\Report\ExcelExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ExcelDownload" => array:2 [ …2]
    "Evaluation\Controller\Plugin\Report\ExcelImport" => array:1 [ …1]
    "Evaluation\Controller\Plugin\Report\PdfExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ConsolidatedPdfExport" => array:10 [ …10]
    "Evaluation\Controller\Plugin\Report\Presentation" => array:2 [ …2]
    "Evaluation\Controller\Plugin\RenderProjectEvaluation" => array:3 [ …3]
    "Evaluation\Service\EvaluationService" => array:1 [ …1]
    "Evaluation\Service\EvaluationReportService" => array:2 [ …2]
    "Evaluation\Service\ReviewerService" => array:1 [ …1]
    "Evaluation\Service\ReviewRosterService" => array:5 [ …5]
    "Evaluation\View\Helper\Report\Progress" => array:2 [ …2]
    "Evaluation\View\Helper\Report\Score" => array:1 [ …1]
    "Press\Controller\ArticleController" => array:5 [ …5]
    "Press\Controller\BureauController" => array:3 [ …3]
    "Press\Controller\PressController" => array:1 [ …1]
    "Press\Service\PressService" => array:2 [ …2]
    "Press\Search\Service\PressSearchService" => array:1 [ …1]
    "Press\View\Handler\PressHandler" => array:7 [ …7]
    "Program\Controller\Plugin\CreateCallFundingOverview" => array:5 [ …5]
    "Program\Controller\Plugin\CreateFundingDownload" => array:3 [ …3]
    "Program\Controller\Plugin\RenderDoa" => array:3 [ …3]
    "Program\Controller\Plugin\RenderNda" => array:3 [ …3]
    "Program\Controller\Plugin\CallSizeSpreadsheet" => array:8 [ …8]
    "Program\Controller\CallController" => array:6 [ …6]
    "Program\Controller\CallCountryManagerController" => array:4 [ …4]
    "Program\Controller\CallManagerController" => array:9 [ …9]
    "Program\Controller\DoaController" => array:4 [ …4]
    "Program\Controller\FunderManagerController" => array:3 [ …3]
    "Program\Controller\NdaController" => array:6 [ …6]
    "Program\Controller\NdaManagerController" => array:8 [ …8]
    "Program\Controller\ProgramManagerController" => array:3 [ …3]
    "Program\Service\ProgramService" => array:5 [ …5]
    "Program\Service\CallService" => array:3 [ …3]
    "Program\View\Handler\ProgramHandler" => array:6 [ …6]
    "Program\View\Helper\CallInformationBox" => array:3 [ …3]
    "Search\Controller\IndexController" => array:1 [ …1]
    "Search\Command\UpdateIndex" => array:1 [ …1]
    "Search\Service\ConsoleService" => array:22 [ …22]
    "Admin\Controller\AccessController" => array:5 [ …5]
    "Admin\Controller\AdminController" => array:9 [ …9]
    "Admin\Controller\QueueController" => array:2 [ …2]
    "Admin\Controller\Api\LogController" => array:1 [ …1]
    "Admin\Controller\UserController" => array:5 [ …5]
    "Admin\Controller\OAuth2Controller" => array:3 [ …3]
    "Admin\Controller\OAuth2\ClientController" => array:3 [ …3]
    "Admin\Controller\OAuth2\ScopeController" => array:2 [ …2]
    "Admin\Controller\StatisticsController" => array:3 [ …3]
    "Admin\Controller\CacheController" => array:1 [ …1]
    "Admin\Controller\FixController" => []
    "Admin\Controller\PermitController" => array:3 [ …3]
    "Admin\InputFilter\AccessFilter" => array:1 [ …1]
    "Admin\Service\AdminService" => array:3 [ …3]
    "Admin\Service\StatisticsService" => array:1 [ …1]
    "Admin\Service\QueueService" => array:1 [ …1]
    "Admin\Service\ApiService" => array:1 [ …1]
    "Admin\Service\OAuth2Service" => array:1 [ …1]
    "Admin\Form\View\Helper\AccessFormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormCheckbox" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterBarElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterColumnElement" => array:2 [ …2]
    "Affiliation\Controller\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\EditController" => array:11 [ …11]
    "Affiliation\Controller\Admin\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\Admin\IndexController" => array:4 [ …4]
    "Affiliation\Controller\Admin\EditController" => array:11 [ …11]
    "Affiliation\Controller\Json\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Json\LoiController" => array:4 [ …4]
    "Affiliation\Controller\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Doa\ManagerController" => array:9 [ …9]
    "Affiliation\Controller\LoiController" => array:5 [ …5]
    "Affiliation\Controller\Loi\ManagerController" => array:7 [ …7]
    "Affiliation\Controller\Questionnaire\CategoryManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireController" => array:4 [ …4]
    "Affiliation\Provider\AffiliationProvider" => array:2 [ …2]
    "Affiliation\Service\AffiliationService" => array:14 [ …14]
    "Affiliation\Service\QuestionnaireService" => array:2 [ …2]
    "Affiliation\Service\DoaService" => array:1 [ …1]
    "Affiliation\Service\LoiService" => array:1 [ …1]
    "Affiliation\Controller\Plugin\RenderPaymentSheet" => array:9 [ …9]
    "Affiliation\Controller\Plugin\RenderLoi" => array:3 [ …3]
    "Affiliation\Controller\Plugin\MergeAffiliation" => array:2 [ …2]
    "Affiliation\View\Helper\PaymentSheet" => array:8 [ …8]
    "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper" => array:1 [ …1]
    "Organisation\Controller\JsonController" => array:3 [ …3]
    "Organisation\Controller\Organisation\NoteController" => array:3 [ …3]
    "Organisation\Controller\ImageController" => array:3 [ …3]
    "Organisation\Controller\BoardController" => array:3 [ …3]
    "Organisation\Controller\Organisation\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Organisation\FinancialController" => array:4 [ …4]
    "Organisation\Controller\Organisation\ListController" => array:2 [ …2]
    "Organisation\Controller\Organisation\ManagerController" => array:7 [ …7]
    "Organisation\Controller\Organisation\TypeController" => array:3 [ …3]
    "Organisation\Controller\AdvisoryBoard\City\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\City\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\AdvisoryBoard\Solution\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\Solution\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\SelectionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ContributionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ManagerController" => array:5 [ …5]
    "Organisation\Controller\Parent\ListController" => array:5 [ …5]
    "Organisation\Controller\Parent\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Parent\OrganisationController" => array:6 [ …6]
    "Organisation\Controller\Parent\TypeController" => array:3 [ …3]
    "Organisation\Controller\Parent\DoaController" => array:6 [ …6]
    "Organisation\Controller\Parent\FinancialController" => array:6 [ …6]
    "Organisation\Controller\UpdateController" => array:4 [ …4]
    "Organisation\Controller\Update\ManagerController" => array:5 [ …5]
    "Organisation\Command\Cleanup" => array:1 [ …1]
    "Organisation\Search\Service\OrganisationSearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => array:1 [ …1]
    "Organisation\View\Handler\OrganisationHandler" => array:9 [ …9]
    "Organisation\View\Handler\AdvisoryBoard\CityHandler" => array:7 [ …7]
    "Organisation\View\Handler\AdvisoryBoard\SolutionHandler" => array:7 [ …7]
    "Organisation\Controller\Plugin\HandleParentAndProjectImport" => array:8 [ …8]
    "Organisation\Controller\Plugin\RenderOverviewExtraVariableContributionSheet" => array:7 [ …7]
    "Organisation\Controller\Plugin\RenderOverviewVariableContributionSheet" => array:8 [ …8]
    "Organisation\Controller\Plugin\Merge\OrganisationMerge" => array:4 [ …4]
    "Organisation\Controller\Plugin\Merge\ParentOrganisationMerge" => array:2 [ …2]
    "Organisation\Controller\Plugin\SelectionExport" => array:2 [ …2]
    "Organisation\Form\OrganisationForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\CityForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\SolutionForm" => array:1 [ …1]
    "Organisation\Form\UpdateForm" => array:1 [ …1]
    "Organisation\Form\FinancialForm" => array:1 [ …1]
    "Organisation\Form\View\Helper\OrganisationFormElement" => array:3 [ …3]
    "Organisation\Form\View\Helper\ParentFormElement" => array:2 [ …2]
    "Organisation\View\Helper\UpdateNotification" => array:2 [ …2]
    "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution" => array:7 [ …7]
    "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution" => array:7 [ …7]
    "Organisation\Service\AdvisoryBoard\CityService" => array:3 [ …3]
    "Organisation\Service\AdvisoryBoard\SolutionService" => array:3 [ …3]
    "Organisation\Service\BoardService" => array:1 [ …1]
    "Organisation\Service\SelectionService" => array:1 [ …1]
    "Organisation\Service\UpdateService" => array:3 [ …3]
    "Publication\Acl\Assertion\Publication" => array:4 [ …4]
    "Publication\Controller\CategoryController" => array:3 [ …3]
    "Publication\Controller\CommunityController" => array:1 [ …1]
    "Publication\Controller\PublicationController" => array:1 [ …1]
    "Publication\Controller\PublicationManagerController" => array:5 [ …5]
    "Publication\Controller\TypeController" => array:4 [ …4]
    "Publication\Search\Service\PublicationSearchService" => array:1 [ …1]
    "Publication\Service\PublicationService" => array:3 [ …3]
    "Invoice\Controller\ConsoleController" => array:1 [ …1]
    "Invoice\Controller\DimensionController" => array:3 [ …3]
    "Invoice\Controller\ExportController" => array:2 [ …2]
    "Invoice\Controller\ForecastController" => array:3 [ …3]
    "Invoice\Controller\InvoiceController" => array:17 [ …17]
    "Invoice\Controller\InvoiceCreateController" => array:15 [ …15]
    "Invoice\Controller\JournalController" => array:1 [ …1]
    "Invoice\Controller\PdfController" => array:1 [ …1]
    "Invoice\Controller\ReminderController" => array:7 [ …7]
    "Invoice\Controller\RowController" => array:4 [ …4]
    "Invoice\Controller\TransactionController" => array:2 [ …2]
    "Invoice\Controller\WordController" => array:1 [ …1]
    "Invoice\Command\DailyUpdate" => array:4 [ …4]
    "Invoice\Command\Sync" => array:1 [ …1]
    "Invoice\Controller\Plugin\CreateCreditInvoice" => array:2 [ …2]
    "Invoice\Controller\Plugin\CreateIncomeForecast" => array:6 [ …6]
    "Invoice\Controller\Plugin\InvoiceExport" => array:3 [ …3]
    "Invoice\Controller\Plugin\InvoiceExportUbl" => array:4 [ …4]
    "Invoice\Controller\Plugin\RenderInvoice" => array:8 [ …8]
    "Invoice\Controller\Plugin\RenderReminder" => array:5 [ …5]
    "Invoice\Controller\Plugin\CreateInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentInvoice" => array:4 [ …4]
    "Invoice\Controller\Plugin\CreateWordInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentExtraInvoice" => array:4 [ …4]
    "Invoice\Service\InvoiceService" => array:9 [ …9]
    "Invoice\Service\TransactionService" => array:3 [ …3]
    "Invoice\Search\Service\InvoiceSearchService" => array:1 [ …1]
    "Invoice\View\Helper\DailyUpdateHandler" => array:2 [ …2]
    "Deeplink\Controller\DeeplinkController" => array:5 [ …5]
    "Deeplink\Controller\TargetController" => array:4 [ …4]
    "Deeplink\InputFilter\TargetFilter" => array:2 [ …2]
    "Deeplink\Service\DeeplinkService" => array:2 [ …2]
    "Deeplink\View\Helper\CanAssemble" => array:1 [ …1]
    "Event\Controller\BadgeImageManagerController" => array:9 [ …9]
    "Event\Controller\BadgeManagerController" => array:13 [ …13]
    "Event\Controller\BoothController" => array:10 [ …10]
    "Event\Controller\BoothManagerController" => array:9 [ …9]
    "Event\Controller\BoothSpecManagerController" => array:4 [ …4]
    "Event\Controller\DeskCostsController" => array:2 [ …2]
    "Event\Controller\ExhibitionCostController" => array:3 [ …3]
    "Event\Controller\ExhibitionSpecManagerController" => array:3 [ …3]
    "Event\Controller\ExhibitionManagerController" => array:5 [ …5]
    "Event\Controller\ExportController" => array:1 [ …1]
    "Event\Controller\JsonController" => array:4 [ …4]
    "Event\Controller\Meeting\AdminController" => array:4 [ …4]
    "Event\Controller\Meeting\MeetingController" => array:9 [ …9]
    "Event\Controller\Meeting\CostController" => array:2 [ …2]
    "Event\Controller\Meeting\QuotaController" => array:4 [ …4]
    "Event\Controller\Meeting\CouponController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionCostController" => array:2 [ …2]
    "Event\Controller\Meeting\FloorplanController" => array:5 [ …5]
    "Event\Controller\Meeting\ManagerController" => array:14 [ …14]
    "Event\Controller\RegistrationController" => array:9 [ …9]
    "Event\Controller\PaymentController" => array:3 [ …3]
    "Event\Controller\RegistrationManagerController" => array:7 [ …7]
    "Event\Controller\TicketManagerController" => array:11 [ …11]
    "Event\Job\CometChat\CreateUser" => array:3 [ …3]
    "Event\Job\CometChat\CreateAuthToken" => array:3 [ …3]
    "Event\Job\CometChat\DeleteUser" => array:3 [ …3]
    "Event\Command\CancelPaymentPending" => array:1 [ …1]
    "Event\Command\UpdateRegistrations" => array:1 [ …1]
    "Event\Controller\Plugin\BoothExport" => array:3 [ …3]
    "Event\Controller\Plugin\RegistrationExport" => array:1 [ …1]
    "Event\Controller\Plugin\RenderReceipt" => array:4 [ …4]
    "Event\Controller\Plugin\MeetingFacebook" => array:4 [ …4]
    "Event\Controller\Plugin\BadgePdf" => array:5 [ …5]
    "Event\Controller\Plugin\TicketPdf" => array:4 [ …4]
    "Event\View\Handler\MeetingHandler" => array:8 [ …8]
    "Event\View\Helper\RegistrationLink" => array:6 [ …6]
    "Event\Search\Service\RegistrationSearchService" => array:1 [ …1]
    "Event\Service\BadgeService" => array:1 [ …1]
    "Event\Service\MeetingService" => array:4 [ …4]
    "Event\Service\ExhibitionService" => array:1 [ …1]
    "Event\Service\BoothService" => array:3 [ …3]
    "Event\Service\RegistrationService" => array:16 [ …16]
    "Event\Service\ExhibitionFloorplanService" => array:1 [ …1]
    "Event\Service\ExhibitionSpecService" => array:1 [ …1]
    "Calendar\Controller\CalendarController" => array:2 [ …2]
    "Calendar\Controller\TypeController" => array:2 [ …2]
    "Calendar\Controller\CommunityController" => array:11 [ …11]
    "Calendar\Controller\DocumentController" => array:4 [ …4]
    "Calendar\Controller\JsonController" => array:1 [ …1]
    "Calendar\Controller\ManagerController" => array:10 [ …10]
    "Calendar\Controller\Plugin\RenderCalendarContactList" => array:3 [ …3]
    "Calendar\Controller\Plugin\RenderReviewCalendar" => array:2 [ …2]
    "Calendar\Service\CalendarService" => array:7 [ …7]
    "Calendar\Search\Service\CalendarSearchService" => array:1 [ …1]
    "Calendar\View\Handler\CalendarHandler" => array:7 [ …7]
    "Mailing\Command\FlushQueue" => array:1 [ …1]
    "Mailing\Command\SendQueue" => array:1 [ …1]
    "Mailing\Controller\AttachmentController" => array:2 [ …2]
    "Mailing\Controller\ConsoleController" => array:1 [ …1]
    "Mailing\Controller\MailingContactController" => array:1 [ …1]
    "Mailing\Controller\MailingManagerController" => array:6 [ …6]
    "Mailing\Controller\JsonController" => array:3 [ …3]
    "Mailing\Controller\MailingSubscriptionController" => array:6 [ …6]
    "Mailing\Controller\SenderManagerController" => array:3 [ …3]
    "Mailing\Controller\TemplateManagerController" => array:3 [ …3]
    "Mailing\InputFilter\MailingFilter" => array:1 [ …1]
    "Mailing\InputFilter\SenderFilter" => array:1 [ …1]
    "Mailing\InputFilter\TemplateFilter" => array:1 [ …1]
    "Mailing\Service\MailingService" => array:4 [ …4]
    "Accounting\Controller\TwinfieldController" => array:2 [ …2]
    "Accounting\Adapter\TwinfieldAdapter" => array:3 [ …3]
  ]
  "lmc_cors" => array:3 [
    "allowed_origins" => array:1 [ …1]
    "allowed_methods" => array:5 [ …5]
    "allowed_headers" => array:3 [ …3]
  ]
  "console" => array:1 [
    "router" => array:1 [ …1]
  ]
  "zfctwig" => array:9 [
    "environment_loader" => "ZfcTwigLoaderChain"
    "environment_class" => "Twig\Environment"
    "environment_options" => array:2 [ …2]
    "loader_chain" => array:3 [ …3]
    "extensions" => array:14 [ …14]
    "suffix" => "twig"
    "enable_fallback_functions" => true
    "disable_zf_model" => false
    "helper_manager" => array:1 [ …1]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [ …6]
    "toolbar" => array:5 [ …5]
    "events" => array:3 [ …3]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:7 [ …7]
    "factories" => array:7 [ …7]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [ …1]
  ]
  "translator" => array:3 [
    "locale" => "en_GB"
    "cache" => true
    "translation_file_patterns" => array:1 [ …1]
  ]
  "web" => array:5 [
    "title" => "ITEA 4"
    "description" => "ITEA is the Eureka R&D&I Cluster programme for software innovation, enabling a large international community to collaborate in funded projects that turn innovative ideas into new businesses, jobs, economic growth and benefits for society."
    "keywords" => "Software-intensive Systems & Services, EUREKA Cluster, R&D, R&D projects, Innovation, Business Impact, Seizing the high ground, Fast Exploitation, Happiness"
    "author" => "Johan van der Heide, johan.van.der.heide[at]itea4.org"
    "site_name" => "itea4.org"
  ]
  "authenticate" => array:1 [
    "useAdditionalEmailAddresses" => true
  ]
  "session_config" => array:3 [
    "cache_expire" => 86400
    "cookie_lifetime" => 86400
    "name" => "itea"
  ]
  "navigation" => array:6 [
    "default" => []
    "project-community" => []
    "community" => array:6 [ …6]
    "admin" => array:14 [ …14]
    "community2" => array:1 [ …1]
    "call" => array:6 [ …6]
  ]
  "content_option" => array:3 [
    "vimeoClientId" => "08fdab5ca150505195e18a91774f67a6bae59cd3"
    "vimeoClientSecret" => "5Dc8mhmhiByGpBp7XFoY7+6rTi5NXGu+OWuU4E97JELWz3oNryFAP0GsbC/h9tvY4KA3dTORoQ31dIk5AGx1HRwjR5t2uXTpZEHMSkWdnjqKi3GFs7acWyzg6mIGEfdV"
    "vimeoAccessToken" => "947086738c8843c59ea7755d410c2288"
  ]
  "general_option" => array:5 [
    "serverUrl" => "https://dev1.itea4.org"
    "thumborServer" => "https://image.itea3.org"
    "thumborSecret" => "mKiWlumnpbX1YWpW6lbm"
    "assets" => "/var/www/dev1/config/itea/../../styles/itea/img"
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "cluster_options" => array:2 [
    "reporting_portal_api_url" => "https://api.eurekaclusters.eu"
    "bearer_token" => "abcd"
  ]
  "slm_queue" => array:6 [
    "job_manager" => array:1 [ …1]
    "queues" => array:1 [ …1]
    "worker_strategies" => array:2 [ …2]
    "strategy_manager" => array:2 [ …2]
    "queue_manager" => array:1 [ …1]
    "worker_manager" => []
  ]
  "project_option" => array:9 [
    "rationale_require_contact_with_funder" => false
    "evaluation_project_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "evaluation_report_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "evaluation_presentation_templates" => array:2 [ …2]
    "evaluation_report_author" => "Itea Office"
    "project_summary_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/project-summary.docx"
    "change_request_document_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/cr-document.docx"
    "header_logo" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/footer.png"
  ]
  "evaluation_options" => array:4 [
    "projectTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "reportTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "presentationTemplates" => array:2 [ …2]
    "reportAuthor" => "ITEA Office"
  ]
  "program_option" => array:6 [
    "nda_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "doa_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "blank_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "has_nda" => true
    "header_logo" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/footer.png"
  ]
  "google" => array:1 [
    "cx" => "009339216969913709813:g_lfsuqxjz0"
  ]
  "solr" => array:2 [
    "host" => "app2"
    "connection" => array:23 [ …23]
  ]
  "admin_option" => array:1 [
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "affiliation_option" => array:3 [
    "doa_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/doa-template.pdf"
    "loi_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/nda-template.pdf"
    "payment_sheet_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "organisation_option" => array:2 [
    "overview_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
    "overview_extra_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
  ]
  "invoice_option" => array:11 [
    "mollie_api_key" => "live_lsaXAz3GAweHE1zzTr15WPt5FEZFeB"
    "payment_days" => 30
    "complaint_days" => 14
    "contract_data_start_year" => 2018
    "invoice_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/pdf/invoice-template.pdf"
    "variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/variable-fee-template.docx"
    "extra_variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/extra-variable-fee-template.docx"
    "invoice_mask" => "YYYY####"
    "local_country" => "NLD"
    "bcc_email_address" => "finance@itea4.org"
    "from_email_address" => "finance@itea4.org"
  ]
  "event_option" => array:1 [
    "receipt_template" => "/var/www/dev1/module/event/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "calendar_option" => array:2 [
    "calendar_contact_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "review_calendar_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/review-calendar-template.pdf"
  ]
  "google_analytics" => array:7 [
    "enable" => true
    "id" => ""
    "domain_name" => ""
    "allow_linker" => false
    "enable_display_advertising" => false
    "anonymize_ip" => false
    "script" => "google-analytics-ga"
  ]
  "accounting_options" => array:5 [
    "clientId" => ""
    "clientSecret" => ""
    "refreshToken" => ""
    "redirectURL" => ""
    "office" => ""
  ]
  "listeners" => array:1 [
    0 => "ErrorHeroModule\Listener\Mvc"
  ]
  "email" => array:3 [
    "general" => array:2 [ …2]
    "smtp" => array:5 [ …5]
    "mailjet" => array:2 [ …2]
  ]
  "log" => array:1 [
    "ErrorHeroModuleLogger" => array:1 [ …1]
  ]
  "error-hero-module" => array:5 [
    "enable" => true
    "enable-error-preview-page" => true
    "display-settings" => array:6 [ …6]
    "logging-settings" => array:1 [ …1]
    "email-notification-settings" => array:5 [ …5]
  ]
  "jield_authorize" => array:6 [
    "default_role" => "public"
    "authenticated_role" => "user"
    "access_service" => "Admin\Service\AdminService"
    "permit_service" => "Contact\Service\ContactService"
    "cache_enabled" => true
    "role_entity_class" => "Admin\Entity\Access"
  ]
  "circlical" => array:1 [
    "recaptcha" => array:3 [ …3]
  ]
  "accounting" => array:2 [
    "adapter" => "Accounting\Adapter\Twinfield"
    "options" => array:7 [ …7]
  ]
  "cache" => array:1 [
    "adapter" => array:2 [ …2]
  ]
  "cometchat" => array:5 [
    "app_id" => "190005357f8fde86"
    "region" => "eu"
    "version" => 2
    "auth_key" => "f333a70ecae8f9362a869d8a5753dea3156109c8"
    "api_key" => "344ac4fb44725064a40306c597afac4ba3430f81"
  ]
  "zfr_cors" => array:1 [
    "allowed_origins" => array:3 [ …3]
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
^ array:3 [
  "modules" => array:63 [
    0 => "Laminas\Cache"
    1 => "Laminas\Router"
    2 => "Laminas\Form"
    3 => "Laminas\Navigation"
    4 => "Laminas\Filter"
    5 => "Laminas\Hydrator"
    6 => "Laminas\InputFilter"
    7 => "Laminas\Paginator"
    8 => "Laminas\Router"
    9 => "Laminas\Log"
    10 => "Laminas\Validator"
    11 => "Laminas\Mvc\Plugin\FlashMessenger"
    12 => "Laminas\Mvc\Plugin\Identity"
    13 => "Laminas\ApiTools"
    14 => "Laminas\ApiTools\Documentation"
    15 => "Laminas\ApiTools\Documentation\Swagger"
    16 => "Laminas\ApiTools\ApiProblem"
    17 => "Laminas\ApiTools\Configuration"
    18 => "Laminas\ApiTools\OAuth2"
    19 => "Laminas\ApiTools\MvcAuth"
    20 => "Laminas\ApiTools\Hal"
    21 => "Laminas\ApiTools\ContentNegotiation"
    22 => "Laminas\ApiTools\ContentValidation"
    23 => "Laminas\ApiTools\Rest"
    24 => "Laminas\ApiTools\Rpc"
    25 => "Laminas\ApiTools\Versioning"
    26 => "Api"
    27 => "LmcCors"
    28 => "AssetManager"
    29 => "ZfcTwig"
    30 => "BjyAuthorize"
    31 => "Jield\Authorize"
    32 => "DoctrineModule"
    33 => "DoctrineORMModule"
    34 => "Application"
    35 => "Content"
    36 => "General"
    37 => "Cluster"
    38 => "News"
    39 => "Contact"
    40 => "Quality"
    41 => "Project"
    42 => "Evaluation"
    43 => "Press"
    44 => "Program"
    45 => "Search"
    46 => "Admin"
    47 => "LaminasBootstrap5"
    48 => "Affiliation"
    49 => "Organisation"
    50 => "Publication"
    51 => "Invoice"
    52 => "Deeplink"
    53 => "Event"
    54 => "Calendar"
    55 => "Mailing"
    56 => "LaminasGoogleAnalytics"
    57 => "Accounting"
    58 => "ErrorHeroModule"
    59 => "CirclicalRecaptcha"
    60 => "SlmQueue"
    61 => "SlmQueueDoctrine"
    62 => "Laminas\DeveloperTools"
  ]
  "module_listener_options" => array:7 [
    "config_glob_paths" => array:2 [
      0 => "config/autoload/{,*.}{global,local}.php"
      1 => "config/itea/{,*.}{global,local}.php"
    ]
    "config_cache_enabled" => false
    "cache_dir" => "/var/www/dev1/config/../data/cache"
    "config_cache_key" => "itea"
    "module_map_cache_enabled" => true
    "module_map_cache_key" => "50b41c6263a4a7e8e9298092a44a713d"
    "module_paths" => array:2 [
      0 => "./module"
      1 => "./vendor"
    ]
  ]
  "service_manager" => array:2 [
    "use_defaults" => true
    "factories" => []
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
BjyAuthorize Current Identity Roles public
BjyAuthorize
Identity Roles - 1 role

public
Doctrine ORM (Queries) 89 queries in 68.39 ms
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.session_id AS session_id_1, t0.session_key AS session_key_2, t0.session_name AS session_name_3, t0.ip AS ip_4, t0.date_start AS date_start_5, t0.date_end AS date_end_6, t0.modified AS modified_7, t0.lifetime AS lifetime_8, t0.hits AS hits_9, t0.data AS data_10, t0.contact_id AS contact_id_11 FROM session t0 WHERE t0.session_key = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'enbra7qlk4ana5c0mj17r45ulv' (length=26)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0019509792327881
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00095391273498535
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00072288513183594
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0014350414276123
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'exploitable-results' (length=19)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00094795227050781
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1492
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00090694427490234
SQL SELECT t0.content_id AS content_id_1, t0.sequence AS sequence_2, t0.handler_id AS handler_id_3, t0.segment_id AS segment_id_4, t0.node_id AS node_id_5 FROM content t0 WHERE t0.node_id = ? ORDER BY t0.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1492
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006868839263916
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 79
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061607360839844
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00058507919311523
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'exploitable-results' (length=19)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00060796737670898
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 115
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010638236999512
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054383277893066
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053095817565918
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00066280364990234
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057196617126465
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0006251335144043
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0006101131439209
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image cobalt dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00066018104553223
SQL SELECT t0.segment_id AS segment_id_1, t0.segment AS segment_2 FROM content_segment t0 WHERE t0.segment_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065088272094727
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 936
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071501731872559
SQL SELECT t0.param_id AS param_id_1, t0.param AS param_2 FROM content_handler_param t0 WHERE t0.param_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 29
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058913230895996
SQL SELECT t0.result_id AS result_id_1, t0.result AS result_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.date_released AS date_released_5, t0.abstract AS abstract_6, t0.html AS html_7, t0.css AS css_8, t0.size AS size_9, t0.date_updated AS date_updated_10, t0.contenttype_id AS contenttype_id_11, t0.contact_id AS contact_id_12, t0.project_id AS project_id_13, t0.type_id AS type_id_14, t0.image_id AS image_id_15 FROM result t0 WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'exploitable-results' (length=19)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00096797943115234
SQL SELECT t0.type_id AS type_id_1, t0.type AS type_2, t0.title AS title_3, t0.description AS description_4, t0.`sequence` AS sequence_5, t0.list_type AS list_type_6, t0.category_id AS category_id_7 FROM result_type t0 WHERE t0.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 19
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00073003768920898
SQL SELECT COUNT(*) AS dctrn_count FROM (SELECT DISTINCT result_id_0 FROM (SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9 FROM result r0_ WHERE r0_.type_id = ? ORDER BY r0_.date_released DESC) dctrn_result) dctrn_table Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 19
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0014181137084961
SQL SELECT DISTINCT result_id_0 FROM (SELECT DISTINCT result_id_0, date_released_4 FROM (SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9 FROM result r0_ WHERE r0_.type_id = ?) dctrn_result_inner ORDER BY date_released_4 DESC) dctrn_result LIMIT 25 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 19
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0013508796691895
SQL SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9, r0_.contenttype_id AS contenttype_id_10, r0_.contact_id AS contact_id_11, r0_.project_id AS project_id_12, r0_.type_id AS type_id_13, r0_.image_id AS image_id_14 FROM result r0_ WHERE r0_.type_id = ? AND r0_.result_id IN (?) ORDER BY r0_.date_released DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 19
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74: array (size=25) 0 => int 7435 1 => int 7430 2 => int 7422 3 => int 7415 4 => int 7400 5 => int 7395 6 => int 7393 7 => int 7380 8 => int 7385 9 => int 7371 10 => int 7370 11 => int 7368 12 => int 7361 13 => int 7357 14 => int 7358 15 => int 7337 16 => int 7330 17 => int 7309 18 => int 7289 19 => int 7291 20 => int 7277 21 => int 7276 22 => int 7265 23 => int 7264 24 => int 7262
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 101
Time 0.0016880035400391
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0012099742889404
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN result_type_access ON t0.access_id = result_type_access.access_id WHERE result_type_access.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 19
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.001147985458374
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00085711479187012
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10463
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00087499618530273
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 20
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0014419555664062
SQL SELECT t0.program_id AS program_id_1, t0.program AS program_2, t0.number AS number_3 FROM program t0 WHERE t0.program_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 3
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0016410350799561
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00084304809570312
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10430
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00072097778320312
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00078082084655762
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10315
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00073599815368652
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 18
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078296661376953
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00062799453735352
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10414
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00075602531433105
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00058794021606445
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10304
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063610076904297
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057506561279297
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10285
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065898895263672
SQL SELECT t0.programcall_id AS programcall_id_1, t0.programcall AS programcall_2, t0.project_number_mask AS project_number_mask_3, t0.instruction_text AS instruction_text_4, t0.docref AS docref_5, t0.po_open_date AS po_open_date_6, t0.po_close_date AS po_close_date_7, t0.loi_submission_date AS loi_submission_date_8, t0.fpp_open_date AS fpp_open_date_9, t0.fpp_close_date AS fpp_close_date_10, t0.doa_submission_date AS doa_submission_date_11, t0.label_announcement_date AS label_announcement_date_12, t0.doa_requirement AS doa_requirement_13, t0.loi_requirement AS loi_requirement_14, t0.project_report AS project_report_15, t0.nda_requirement AS nda_requirement_16, t0.challenge_per_project AS challenge_per_project_17, t0.active AS active_18, t0.call_stages AS call_stages_19, t0.po_has_work_packages AS po_has_work_packages_20, t0.has_online_work_packages AS has_online_work_packages_21, t0.program_id AS program_id_22, t23.tool_id AS tool_id_24, t23.name AS name_25, t23.title AS title_26, t23.docref AS docref_27, t23.description AS description_28, t23.has_nda AS has_nda_29, t23.has_poster AS has_poster_30, t23.poster_html AS poster_html_31, t23.poster_master AS poster_master_32, t23.has_presentation AS has_presentation_33, t23.has_workgroup_sessions AS has_workgroup_sessions_34, t23.show_on_community AS show_on_community_35, t23.date_created AS date_created_36, t23.date_updated AS date_updated_37, t23.date_open AS date_open_38, t23.date_closed AS date_closed_39, t23.list_css AS list_css_40, t23.list_classes AS list_classes_41, t23.programcall_id AS programcall_id_42, t23.meeting_id AS meeting_id_43, t23.challenge_id AS challenge_id_44 FROM programcall t0 LEFT JOIN idea_tool t23 ON t23.programcall_id = t0.programcall_id WHERE t0.programcall_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 17
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00076198577880859
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00059103965759277
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10293
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00070309638977051
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00059294700622559
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10411
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063896179199219
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00068187713623047
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10449
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006859302520752
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00059795379638672
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10399
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00080204010009766
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060701370239258
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10271
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064897537231445
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00058913230895996
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00062298774719238
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10410
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064802169799805
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00056099891662598
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10439
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064897537231445
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00058388710021973
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10381
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064587593078613
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00056600570678711
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10349
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00066494941711426
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0005948543548584
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10374
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065994262695312
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00066900253295898
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10334
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071310997009277
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00063109397888184
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10305
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082302093505859
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00076818466186523
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10317
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00077009201049805
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00070285797119141
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10302
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00066518783569336
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0006110668182373
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10318
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00077581405639648
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00069594383239746
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10290
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00077009201049805
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00065207481384277
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10329
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00074195861816406
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00066399574279785
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10312
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071501731872559
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.0008080005645752
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'exploitable-results' (length=19)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00069212913513184
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.topic_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 48
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065088272094727
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1477
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00075507164001465
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1504
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062179565429688
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060677528381348
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058889389038086
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1587
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00052618980407715
Doctrine ORM (Mappings) 389 mappings
DoctrineORMModule Mappings for doctrine.mapping_collector.orm_default