ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 page header old-green dots

ITEA organisation & bodies

The main tasks of the ITEA organisation are to:

Four bodies are in place – the Board, the Board Support Group and the Steering Group supported by the fourth - the ITEA Office - to achieve these goals in combination with efficient procedures and the implementation of an overall communications policy.

The different tasks of the bodies are shown in the figure below:

organisation

 

The ITEA Board

As the top executive body in ITEA, the Board is responsible for the strategy and coherence of the whole programme. It establishes general rules for programme management, communicates with Public Authorities for programme strategy and co-funding, and issues ITEA labels.

Airbus Enerim Nokia Siemens
Barco Ericsson NXP Software AG
Bosch Esri Canada Philips Thales
Bull KoçSistem Saab Turkcell Technology

Non-voting members
Chairwoman
Zeynep Sarılar
Vice-chairman
Jean-François Lavignon
Office Director
Jan Jonker

 

Board Support Group

The Board is assisted by the Board Support Group, which approves project proposals and recommends projects for labelling. It is responsible for preparing board decisions and board meetings, and provides guidance to the Steering Group, taking into account the strategic objectives and resources of ITEA. It communicates with the ITEA Authorities Committee (ITAC).

Steering Group

The ITEA Steering Group is the technical brain behind the programme. It makes recommendations on strategic orientation and is responsible for the initiation of projects, their evaluation and monitoring. It recommends projects for selection and labelling, and for priority setting and ranking by the ITEA Board Support Group.

ITEA and the Public Authorities

The Public Authorities harmonise and synchronise measures related to the ITEA 3 programme to ensure continuity and optimal execution of the programme. A Directors Committee and an Authorities Committee communicate directly with respectively the ITEA Board and the ITEA Board Support Group.


Laminas
Documentation Modules Gallery PHP Version 8.0.14 Extensions intl ModulesLaminas\CacheLaminas\RouterLaminas\FormLaminas\NavigationLaminas\FilterLaminas\HydratorLaminas\InputFilterLaminas\PaginatorLaminas\LogLaminas\ValidatorLaminas\Mvc\Plugin\FlashMessengerLaminas\Mvc\Plugin\IdentityLaminas\ApiToolsLaminas\ApiTools\DocumentationLaminas\ApiTools\Documentation\SwaggerLaminas\ApiTools\ApiProblemLaminas\ApiTools\ConfigurationLaminas\ApiTools\OAuth2Laminas\ApiTools\MvcAuthLaminas\ApiTools\HalLaminas\ApiTools\ContentNegotiationLaminas\ApiTools\ContentValidationLaminas\ApiTools\RestLaminas\ApiTools\RpcLaminas\ApiTools\VersioningApiLmcCorsAssetManagerZfcTwigBjyAuthorizeJield\AuthorizeDoctrineModuleDoctrineORMModuleApplicationContentGeneralClusterNewsContactQualityProjectEvaluationPressProgramSearchAdminLaminasBootstrap5AffiliationOrganisationPublicationInvoiceDeeplinkEventCalendarMailingLaminasGoogleAnalyticsAccountingErrorHeroModuleCirclicalRecaptchaSlmQueueSlmQueueDoctrineLaminas\DeveloperTools
Request and Response 200 NodeController::node on content-route-1
Status code 200 Method GET Controller Content\Controller\NodeController Action node Other Route Parameters
^ array:1 [
  "docRef" => "organisation"
]
Route content-route-1 Template layout/layout

  content: string

Template content/node/node

  node: Content\Entity\Node

Execution Time 289.33 ms
1. route 108.26 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
2. authentication 111.77 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
3. authentication.post 112.00 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
4. authorization 112.15 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
5. authorization.post 112.33 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
6. dispatch 164.88 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
7. dispatch 165.34 ms
File: src/DispatchListener.php - Line: 132
Target: Content\Controller\NodeController
8. render 168.93 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
9. renderer 184.27 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
10. renderer.post 184.36 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
11. renderer 184.44 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
12. renderer.post 184.52 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
13. isAllowed 271.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
14. isAllowed 271.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
15. isAllowed 271.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
16. isAllowed 271.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
17. isAllowed 272.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
18. isAllowed 272.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
19. isAllowed 272.14 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
20. isAllowed 272.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
21. isAllowed 272.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
22. isAllowed 272.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
23. isAllowed 272.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
24. isAllowed 272.43 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
25. isAllowed 272.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
26. isAllowed 272.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
27. isAllowed 272.63 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
28. isAllowed 272.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
29. isAllowed 272.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
30. isAllowed 272.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
31. isAllowed 272.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
32. isAllowed 272.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
33. isAllowed 272.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
34. isAllowed 273.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
35. isAllowed 273.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
36. isAllowed 273.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
37. isAllowed 273.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
38. isAllowed 273.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
39. isAllowed 273.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
40. isAllowed 273.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
41. isAllowed 273.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
42. isAllowed 273.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
43. isAllowed 273.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
44. isAllowed 273.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
45. isAllowed 273.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
46. isAllowed 273.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
47. isAllowed 273.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
48. isAllowed 273.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
49. isAllowed 273.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
50. isAllowed 273.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
51. isAllowed 274.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
52. isAllowed 274.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
53. isAllowed 274.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
54. isAllowed 274.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
55. isAllowed 274.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
56. isAllowed 274.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
57. isAllowed 274.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
58. isAllowed 274.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
59. isAllowed 274.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
60. isAllowed 274.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
61. isAllowed 274.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
62. isAllowed 274.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
63. isAllowed 274.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
64. isAllowed 274.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
65. isAllowed 274.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
66. isAllowed 274.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
67. isAllowed 274.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
68. isAllowed 274.96 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
69. isAllowed 275.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
70. isAllowed 275.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
71. isAllowed 275.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
72. isAllowed 275.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
73. isAllowed 275.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
74. isAllowed 275.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
75. isAllowed 275.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
76. isAllowed 276.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
77. isAllowed 276.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
78. isAllowed 276.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
79. isAllowed 276.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
80. isAllowed 276.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
81. isAllowed 276.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
82. isAllowed 276.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
83. isAllowed 276.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
84. isAllowed 276.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
85. isAllowed 277.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
86. isAllowed 277.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
87. isAllowed 277.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
88. isAllowed 277.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
89. isAllowed 277.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
90. isAllowed 277.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
91. isAllowed 277.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
92. isAllowed 277.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
93. isAllowed 277.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
94. isAllowed 278.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
95. isAllowed 278.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
96. isAllowed 278.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
97. isAllowed 278.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
98. isAllowed 278.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
99. isAllowed 278.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
100. isAllowed 278.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
101. isAllowed 279.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
102. isAllowed 279.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
103. isAllowed 279.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
104. isAllowed 279.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
105. isAllowed 279.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
106. isAllowed 279.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
107. isAllowed 279.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
108. isAllowed 279.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
109. isAllowed 279.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
110. isAllowed 280.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
111. isAllowed 280.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
112. isAllowed 280.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
113. isAllowed 280.32 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
114. isAllowed 280.48 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
115. isAllowed 280.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
116. isAllowed 280.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
117. isAllowed 280.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
118. isAllowed 280.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
119. isAllowed 280.96 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
120. isAllowed 281.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
121. isAllowed 281.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
122. isAllowed 281.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
123. isAllowed 281.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
124. isAllowed 281.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
125. isAllowed 281.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
126. isAllowed 281.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
127. isAllowed 281.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
128. isAllowed 282.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
129. isAllowed 282.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
130. isAllowed 282.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
131. isAllowed 282.37 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
132. isAllowed 282.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
133. isAllowed 282.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
134. isAllowed 282.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
135. isAllowed 283.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
136. isAllowed 283.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
137. isAllowed 283.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
138. isAllowed 283.48 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
139. isAllowed 283.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
140. isAllowed 283.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
141. isAllowed 283.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
142. isAllowed 283.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
143. isAllowed 283.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
144. isAllowed 283.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
145. isAllowed 283.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
146. isAllowed 283.96 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
147. isAllowed 284.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
148. isAllowed 284.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
149. isAllowed 284.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
150. isAllowed 284.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
151. isAllowed 284.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
152. isAllowed 284.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
153. isAllowed 284.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
154. isAllowed 284.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
155. isAllowed 284.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
156. isAllowed 284.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
157. isAllowed 284.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
158. isAllowed 284.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
159. isAllowed 284.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
160. isAllowed 284.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
161. isAllowed 284.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
162. isAllowed 284.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
163. isAllowed 285.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
164. isAllowed 285.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
165. isAllowed 285.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
166. isAllowed 285.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
167. isAllowed 285.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
168. isAllowed 285.30 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
169. isAllowed 285.37 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
170. isAllowed 285.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
171. isAllowed 285.48 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
172. isAllowed 285.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
173. isAllowed 285.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
174. isAllowed 285.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
175. isAllowed 285.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
176. isAllowed 285.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
177. isAllowed 285.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
178. isAllowed 285.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
179. isAllowed 285.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
180. isAllowed 286.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
181. isAllowed 286.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
182. isAllowed 286.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
183. isAllowed 286.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
184. isAllowed 286.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
185. isAllowed 286.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
186. isAllowed 286.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
187. isAllowed 286.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
188. isAllowed 286.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
189. isAllowed 286.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
190. isAllowed 286.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
191. response 288.33 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
192. finish 288.43 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
193. collected 824.15 ms
File: Listener/ProfilerListener.php - Line: 86
Target: NULL
Total Time 289.33 ms
Memory Peak 2.00 MB
1. route 2.00 MB

public/index.php - Line: 31

2. authentication 2.00 MB

src/EventManager.php - Line: 319

3. authentication.post 2.00 MB

src/EventManager.php - Line: 319

4. authorization 2.00 MB

src/EventManager.php - Line: 319

5. authorization.post 2.00 MB

src/EventManager.php - Line: 319

6. dispatch 2.00 MB

public/index.php - Line: 31

7. dispatch 2.00 MB

src/DispatchListener.php - Line: 132

8. render 2.00 MB

src/Application.php - Line: 341

9. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

10. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

11. renderer 2.00 MB

src/View.php - Line: 222

12. renderer.post 2.00 MB

src/View.php - Line: 222

13. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

14. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

15. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

16. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

17. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

18. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

19. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

20. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

21. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

22. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

23. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

24. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

25. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

26. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

27. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

28. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

29. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

30. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

31. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

32. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

33. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

34. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

35. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

36. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

37. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

38. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

39. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

40. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

41. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

42. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

43. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

44. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

45. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

46. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

47. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

48. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

49. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

50. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

51. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

52. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

53. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

54. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

55. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

56. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

57. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

58. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

59. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

60. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

61. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

62. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

63. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

64. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

65. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

66. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

67. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

68. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

69. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

70. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

71. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

72. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

73. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

74. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

75. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

76. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

77. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

78. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

79. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

80. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

81. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

82. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

83. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

84. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

85. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

86. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

87. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

88. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

89. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

90. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

91. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

92. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

93. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

94. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

95. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

96. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

97. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

98. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

99. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

100. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

101. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

102. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

103. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

104. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

105. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

106. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

107. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

108. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

109. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

110. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

111. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

112. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

113. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

114. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

115. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

116. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

117. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

118. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

119. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

120. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

121. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

122. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

123. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

124. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

125. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

126. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

127. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

128. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

129. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

130. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

131. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

132. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

133. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

134. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

135. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

136. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

137. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

138. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

139. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

140. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

141. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

142. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

143. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

144. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

145. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

146. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

147. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

148. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

149. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

150. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

151. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

152. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

153. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

154. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

155. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

156. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

157. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

158. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

159. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

160. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

161. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

162. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

163. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

164. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

165. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

166. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

167. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

168. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

169. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

170. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

171. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

172. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

173. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

174. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

175. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

176. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

177. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

178. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

179. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

180. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

181. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

182. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

183. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

184. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

185. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

186. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

187. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

188. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

189. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

190. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

191. response 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

192. finish 2.00 MB

src/Application.php - Line: 341

193. collected 2.00 MB

Listener/ProfilerListener.php - Line: 86

Memory Peak 2.00 MB
Config Config
Merged Config (Config)
^ array:66 [
  "service_manager" => array:7 [
    "abstract_factories" => array:11 [
      0 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      1 => "Laminas\Form\FormAbstractServiceFactory"
      2 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      3 => "Laminas\Log\LoggerAbstractServiceFactory"
      4 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      6 => "Laminas\ApiTools\DbConnectedResourceAbstractFactory"
      7 => "Laminas\ApiTools\TableGatewayAbstractFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      8 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      9 => "Laminas\Log\LoggerAbstractServiceFactory"
    ]
    "factories" => array:731 [
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\Navigation\Navigation" => "Laminas\Navigation\Service\DefaultNavigationFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "Laminas\ApiTools\MvcAuth\UnauthenticatedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\UnauthorizedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\Factory\ApiFactoryFactory"
      "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategyFactory"
      "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Factory\RenderErrorListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Factory\SendApiProblemResponseListenerFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemRendererFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemStrategyFactory"
      "Laminas\ApiTools\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\Factory\ConfigResourceFactory"
      "Laminas\ApiTools\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\Factory\ResourceFactoryFactory"
      "Laminas\ApiTools\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\Factory\ConfigWriterFactory"
      "Laminas\ApiTools\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\Factory\ModuleUtilsFactory"
      "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter" => "Application\Authentication\Factory\PdoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Factory\MongoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationServiceFactory"
      "Laminas\ApiTools\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\MvcAuth\Factory\NamedOAuth2ServerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication" => "Laminas\ApiTools\MvcAuth\Factory\AuthenticationServiceFactory"
      "Laminas\ApiTools\MvcAuth\ApacheResolver" => "Laminas\ApiTools\MvcAuth\Factory\ApacheResolverFactory"
      "Laminas\ApiTools\MvcAuth\FileResolver" => "Laminas\ApiTools\MvcAuth\Factory\FileResolverFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthenticationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\AuthHttpAdapter" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthHttpAdapterFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization" => "Laminas\ApiTools\MvcAuth\Factory\AclAuthorizationFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthorizationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultResourceResolverListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultResourceResolverListenerFactory"
      "Laminas\Authentication\Storage\NonPersistent" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Factory\LinkExtractorFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Factory\LinkCollectionExtractorFactory"
      "Laminas\ApiTools\Hal\HalConfig" => "Laminas\ApiTools\Hal\Factory\HalConfigFactory"
      "Laminas\ApiTools\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\Factory\HalJsonRendererFactory"
      "Laminas\ApiTools\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\Factory\HalJsonStrategyFactory"
      "Laminas\ApiTools\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Factory\LinkUrlBuilderFactory"
      "Laminas\ApiTools\Hal\MetadataMap" => "Laminas\ApiTools\Hal\Factory\MetadataMapFactory"
      "Laminas\ApiTools\Hal\RendererOptions" => "Laminas\ApiTools\Hal\Factory\RendererOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentTypeFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentNegotiationOptions" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentNegotiationOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\HttpMethodOverrideListener" => "Laminas\ApiTools\ContentNegotiation\Factory\HttpMethodOverrideListenerFactory"
      "Laminas\ApiTools\ContentValidation\ContentValidationListener" => "Laminas\ApiTools\ContentValidation\ContentValidationListenerFactory"
      "Laminas\ApiTools\Rest\OptionsListener" => "Laminas\ApiTools\Rest\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Rpc\OptionsListener" => "Laminas\ApiTools\Rpc\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\Factory\ContentTypeListenerFactory"
      "Laminas\ApiTools\Versioning\VersionListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Api\V1\Rest\ContactResource\MeListener" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "LmcCors\Mvc\CorsRequestListener" => "LmcCors\Factory\CorsRequestListenerFactory"
      "LmcCors\Options\CorsOptions" => "LmcCors\Factory\CorsOptionsFactory"
      "LmcCors\Service\CorsService" => "LmcCors\Factory\CorsServiceFactory"
      "AssetManager\Service\AssetManager" => "AssetManager\Service\AssetManagerServiceFactory"
      "AssetManager\Service\AssetFilterManager" => "AssetManager\Service\AssetFilterManagerServiceFactory"
      "AssetManager\Service\AssetCacheManager" => "AssetManager\Service\AssetCacheManagerServiceFactory"
      "AssetManager\Resolver\AggregateResolver" => "AssetManager\Service\AggregateResolverServiceFactory"
      "AssetManager\Resolver\MapResolver" => "AssetManager\Service\MapResolverServiceFactory"
      "AssetManager\Resolver\PathStackResolver" => "AssetManager\Service\PathStackResolverServiceFactory"
      "AssetManager\Resolver\PrioritizedPathsResolver" => "AssetManager\Service\PrioritizedPathsResolverServiceFactory"
      "AssetManager\Resolver\CollectionResolver" => "AssetManager\Service\CollectionResolverServiceFactory"
      "AssetManager\Resolver\ConcatResolver" => "AssetManager\Service\ConcatResolverServiceFactory"
      "AssetManager\Resolver\AliasPathStackResolver" => "AssetManager\Service\AliasPathStackResolverServiceFactory"
      "Twig\Environment" => "ZfcTwig\Twig\EnvironmentFactory"
      "Twig\Loader\ChainLoader" => "ZfcTwig\Twig\ChainLoaderFactory"
      "ZfcTwig\Twig\Extension" => "ZfcTwig\Twig\ExtensionFactory"
      "ZfcTwig\Twig\MapLoader" => "ZfcTwig\Twig\MapLoaderFactory"
      "ZfcTwig\Twig\StackLoader" => "ZfcTwig\Twig\StackLoaderFactory"
      "ZfcTwig\View\TwigRenderer" => "ZfcTwig\View\TwigRendererFactory"
      "ZfcTwig\View\TwigResolver" => "ZfcTwig\View\TwigResolverFactory"
      "ZfcTwig\View\HelperPluginManager" => "ZfcTwig\View\HelperPluginManagerFactory"
      "ZfcTwig\View\TwigStrategy" => "ZfcTwig\View\TwigStrategyFactory"
      "ZfcTwig\ModuleOptions" => "ZfcTwig\ModuleOptionsFactory"
      "BjyAuthorize\Cache" => "BjyAuthorize\Service\CacheFactory"
      "BjyAuthorize\CacheKeyGenerator" => "BjyAuthorize\Service\CacheKeyGeneratorFactory"
      "BjyAuthorize\Config" => "Jield\Authorize\Factory\ConfigServiceFactory"
      "BjyAuthorize\Guards" => "BjyAuthorize\Service\GuardsServiceFactory"
      "BjyAuthorize\RoleProviders" => "BjyAuthorize\Service\RoleProvidersServiceFactory"
      "BjyAuthorize\ResourceProviders" => "BjyAuthorize\Service\ResourceProvidersServiceFactory"
      "BjyAuthorize\RuleProviders" => "BjyAuthorize\Service\RuleProvidersServiceFactory"
      "BjyAuthorize\Service\RoleDbTableGateway" => "BjyAuthorize\Service\UserRoleServiceFactory"
      "BjyAuthorize\Collector\RoleCollector" => "BjyAuthorize\Service\RoleCollectorServiceFactory"
      "BjyAuthorize\Guard\Controller" => "BjyAuthorize\Service\ControllerGuardServiceFactory"
      "BjyAuthorize\Guard\Route" => "BjyAuthorize\Service\RouteGuardServiceFactory"
      "BjyAuthorize\Provider\Identity\AuthenticationIdentityProvider" => "BjyAuthorize\Service\AuthenticationIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\LmcUserLaminasDb" => "BjyAuthorize\Service\LmcUserLaminasDbIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\ProviderInterface" => "BjyAuthorize\Service\IdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Resource\Config" => "BjyAuthorize\Service\ConfigResourceProviderServiceFactory"
      "BjyAuthorize\Provider\Role\Config" => "BjyAuthorize\Service\ConfigRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\LaminasDb" => "BjyAuthorize\Service\LaminasDbRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\ObjectRepositoryProvider" => "BjyAuthorize\Service\ObjectRepositoryRoleProviderFactory"
      "BjyAuthorize\Provider\Rule\Config" => "BjyAuthorize\Service\ConfigRuleProviderServiceFactory"
      "BjyAuthorize\Service\Authorize" => "BjyAuthorize\Service\AuthorizeFactory"
      "BjyAuthorize\View\UnauthorizedStrategy" => "BjyAuthorize\Service\UnauthorizedStrategyServiceFactory"
      "Jield\Authorize\View\UnauthorizedStrategy" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Jield\Authorize\Service\AuthorizeService" => "Jield\Authorize\Factory\AuthorizeServiceFactory"
      "Jield\Authorize\Service\AssertionService" => "Jield\Authorize\Factory\AssertionServiceFactory"
      "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider" => "Jield\Authorize\Factory\AuthenticationIdentityProviderFactory"
      "Jield\Authorize\Rule\RulesWithAssertion" => "Jield\Authorize\Factory\RuleWithAssertionFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "doctrine.cache.application_cache" => "Application\Factory\StorageCacheFactory"
      "Laminas\Cache\Storage\Adapter\Redis" => "Application\Factory\LaminasCacheFactory"
      "Application\Event\InjectAclInNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\SetTitle" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Application\Event\BlockInactiveContact" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\RegisterPageview" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\I18n\Translator\TranslatorInterface" => "Application\Factory\TranslatorServiceFactory"
      "Application\Service\FormService" => "Application\Factory\FormServiceFactory"
      "Application\Options\ModuleOptions" => "Application\Factory\ModuleOptionsFactory"
      "Application\Authentication\Storage\AuthenticationStorage" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Authentication\AuthenticationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Session\SaveHandler\DoctrineGateway" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Twig\DatabaseTwigLoader" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "cms_navigation" => "Content\Navigation\Factory\ContentNavigationFactory"
      "Content\Service\ContentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\NodeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\VimeoService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\ArticleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\RouteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Event\InitRoutes" => "Application\Factory\InvokableFactory"
      "Content\InputFilter\HandlerFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\RouteFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\SegmentFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TopicFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Options\ModuleOptions" => "Content\Factory\ModuleOptionsFactory"
      "Content\Navigation\Service\ContentNavigationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ContentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\HandlerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\NodeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ParamLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\RouteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\SegmentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Content\Acl\Assertion\Node" => "Application\Factory\InvokableFactory"
      "General\Options\ModuleOptions" => "General\Factory\ModuleOptionsFactory"
      "General\Options\EmailOptions" => "General\Factory\EmailOptionsFactory"
      "General\InputFilter\ChallengeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\Challenge\TypeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\CountryFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\GenderFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\LanguageFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\ExchangeRateFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\TitleFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\WebInfoFilter" => "Application\Factory\InputFilterFactory"
      "General\Service\GeneralService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\CountryService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\EmailService" => "Application\Factory\InvokableFactory"
      "General\Search\Service\CountrySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Mail\Transport\Smtp" => "General\Factory\SmtpTransportFactory"
      "Laminas\Mail\Transport\Sendmail" => "General\Factory\SendmailTransportFactory"
      "Mailjet\Client" => "General\Factory\MailjetClientFactory"
      "General\Navigation\Invokable\ChallengeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ChallengeTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ContentTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\EmailMessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\Country\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LanguageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CurrencyLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\PasswordLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\GenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\TitleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\WebInfoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Cluster\Command\UpdateProject" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Command\GenerateProjectJson" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Options\ModuleOptions" => "Cluster\Factory\ModuleOptionsFactory"
      "Cluster\Acl\Assertion\ClusterAssertion" => "Application\Factory\InvokableFactory"
      "Cluster\Form\ClusterForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\InputFilter\ClusterFilter" => "Application\Factory\InputFilterFactory"
      "Cluster\Service\ClusterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Navigation\Invokable\ClusterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Service\NewsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\BlogService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\MagazineService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\InputFilter\Blog\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\Blog\TagFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\News\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\MagazineFilter" => "Application\Factory\InputFilterFactory"
      "News\Acl\Assertion\Magazine" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Magazine\Article" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Blog" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\News" => "Application\Factory\InvokableFactory"
      "News\Search\Service\NewsSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Search\Service\BlogSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Navigation\Invokable\BlogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\TagLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\NewsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\News\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\MagazineLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Magazine\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Command\ResetAccess" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Provider\ContactProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Contact\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\FacebookLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\OptInLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\AddressLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\DndLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\NoteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\PhoneLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Selection\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\LeaveLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\SelectionContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\AddressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\Office\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\ContactForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\InputFilter\AddressFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\PhoneFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\FacebookFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\DndFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\OptInFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Selection\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\LeaveFilter" => "Application\Factory\InputFilterFactory"
      "Contact\Search\Service\ContactSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Search\Service\ProfileSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Acl\Assertion\Address" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Profile" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Facebook" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Note" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Phone" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Selection" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\ContactAssertion" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\LeaveAssertion" => "Application\Factory\InvokableFactory"
      "Quality\Service\QualityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\Navigation\Invokable\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\SourceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\PhaseLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\YearLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\KpiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\PhaseFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\YearFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\KpiFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\TargetFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\Provider\ProjectProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Provider\Version\VersionProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Acl\Assertion\ChangeRequest\CostChange" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Country" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Process" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Description\Description" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Document\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool\Session" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Idea" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Image" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Partner" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Video" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Poster\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Item" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WorkpackageDescription" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Report" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WindowAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Window\ProjectAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Result\Result" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Version" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Task" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Workpackage" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResultAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\LinkAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\DocumentAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Action" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Pca" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Help" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\HelpFaq" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Log" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Project" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Rationale" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Roadmap" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Calendar\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Project\Service\ProjectService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\KeywordService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AchievementService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Achievement\ExploitableResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionDocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Report\WindowService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\WorkpackageService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ContractService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DescriptionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\IdeaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\Tool\SessionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\HelpService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\InviteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ChangeRequestService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ActionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AwardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\EventService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\ProjectForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\Deliverable\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DeliverableFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\TaskFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AchievementFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\ExploitableResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ProjectFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Action\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AwardFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Award\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CostChangeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Document\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Description\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Event\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\ReportFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\WorkpackageDescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\RationaleFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\Version\VersionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\IdeaFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\ToolFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Description\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Tool\SessionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\FeeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\LogFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\HelpFilter" => "Application\Factory\InputFilterFactory"
      "Project\Options\ModuleOptions" => "Project\Factory\ModuleOptionsFactory"
      "Project\Navigation\Service\HelpNavigationService" => "Project\Navigation\Factory\HelpNavigationServiceFactory"
      "Project\Navigation\Invokable\AchievementLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinkLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinksLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Link\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Document\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\AwardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Award\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CostChangeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\RationaleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Document\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ContractLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Contract\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\FeeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpFaqLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\IdeaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\ToolLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Tool\SessionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Description\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PartnerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Meeting\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Poster\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\ItemLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WorkpackageDescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\Type\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Version\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\WorkpackageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\TaskLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DeliverableLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CalendarReviewLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Search\Service\AchievementSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\Achievement\ExploitableResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\IdeaSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\DescriptionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ProjectSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\WorkpackageDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ActionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Acl\Assertion\FeedbackAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\EvaluationAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReportAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\InputFilter\Report\Criterion\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TopicFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\Service\EvaluationReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\EvaluationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewRosterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewerService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\CriterionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Reviewer\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluateProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\FeedbackLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Options\ModuleOptions" => "Evaluation\Options\Factory\ModuleOptionsFactory"
      "Press\Service\PressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Search\Service\PressSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Press\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Press\Navigation\Invokable\BureauLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Service\ProgramService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\Service\CallService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\ProgramFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\FunderFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CallFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Program\Options\ModuleOptions" => "Program\Factory\ModuleOptionsFactory"
      "Program\Acl\Assertion\Doa" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Funder" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Nda" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Call\Country" => "Application\Factory\InvokableFactory"
      "Program\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Program\Navigation\Invokable\CallLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\FunderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\NdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\ProgramLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\UploadNdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Search\Command\UpdateIndex" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Search\Service\ConsoleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\AdminService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\QueueService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\ApiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\OAuth2Service" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\InputFilter\AccessFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Navigation\Invokable\AccessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ClientLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ScopeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\EntityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\RoleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\SetterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Api\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\QueueLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Provider\AffiliationProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\AffiliationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\QuestionnaireService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\DoaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\LoiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\InputFilter\AffiliationFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\Options\ModuleOptions" => "Affiliation\Factory\ModuleOptionsFactory"
      "Affiliation\Acl\Assertion\AffiliationAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\LoiAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\QuestionnaireAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Navigation\Invokable\AffiliationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\LoiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionnaireLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Options\ModuleOptions" => "Organisation\Factory\ModuleOptionsFactory"
      "Organisation\Form\OrganisationForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\CityForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\SolutionForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\UpdateForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\FinancialForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\OrganisationService" => "Application\Factory\InvokableFactory"
      "Organisation\Service\UpdateService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\BoardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\CityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\SolutionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\ParentService" => "Application\Factory\InvokableFactory"
      "Organisation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\BoardFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\OrganisationFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\ParentEntityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\Parent\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\CityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\SolutionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\Acl\Assertion\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\NoteAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\ParentAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\UpdateAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\FinancialAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\CityAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\SolutionAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Search\Service\OrganisationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Navigation\Invokable\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\BoardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\ParentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\UpdateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\FinancialLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\CityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\SolutionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Service\PublicationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\InputFilter\PublicationFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Publication\Search\Service\PublicationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\Acl\Assertion\Publication" => "Application\Factory\InvokableFactory"
      "Publication\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Publication\Navigation\Invokable\PublicationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeCategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Command\DailyUpdate" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Command\Sync" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\TransactionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\InvoiceService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Options\ModuleOptions" => "Invoice\Factory\ModuleOptionsFactory"
      "Invoice\Search\Service\InvoiceSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Acl\Assertion\Invoice" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Journal" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Method" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Pdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Reminder" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\ReminderPdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Row" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Transaction" => "Application\Factory\InvokableFactory"
      "Invoice\Navigation\Invokable\InvoiceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\JournalLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\TransactionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\ReminderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\RowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\VatDimensionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Deeplink\Service\DeeplinkService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\InputFilter\TargetFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Command\CancelPaymentPending" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Command\UpdateRegistrations" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Navigation\Invokable\BoothLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BoothSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskCostsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\CouponLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationDeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingQuotaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingFloorplanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\TicketLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Service\BadgeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\BoothService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\RegistrationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionFloorplanService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionSpecService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\InputFilter\Badge\AttachmentFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\DeskCostsFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\QuotaFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\OptionCostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\ExhibitionFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\SpecFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Booth\BoothFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\RegistrationFilter" => "Application\Factory\InputFilterFactory"
      "Event\Options\ModuleOptions" => "Event\Factory\ModuleOptionsFactory"
      "Event\Options\CometChatApiOptions" => "Event\Factory\CometChatApiOptionsFactory"
      "Event\Search\Service\RegistrationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Acl\Assertion\Badge" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Booth" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\BoothSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Exhibition" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\ExhibitionSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Meeting" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\MeetingFloorplan" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Registration" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Ticket" => "Application\Factory\InvokableFactory"
      "Calendar\Service\CalendarService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Options\ModuleOptions" => "Calendar\Factory\ModuleOptionsFactory"
      "Calendar\Acl\Assertion\Calendar" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Document" => "Application\Factory\InvokableFactory"
      "Calendar\Search\Service\CalendarSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Navigation\Invokable\CalendarLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Calendar\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Command\FlushQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Command\SendQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Service\MailingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\MailingFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\SenderFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Navigation\Invokable\MailingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\SenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "LaminasGoogleAnalytics\Analytics\Tracker" => "LaminasGoogleAnalytics\Service\TrackerFactory"
      "LaminasGoogleAnalytics\Service\ScriptFactory" => "LaminasGoogleAnalytics\Service\ScriptFactory"
      "Accounting\Adapter\TwinfieldAdapter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Accounting\Options\ModuleOptions" => "Accounting\Factory\ModuleOptionsFactory"
      "ErrorHeroModule\Listener\Mvc" => "ErrorHeroModule\Listener\MvcFactory"
      "ErrorHeroModule\Handler\Logging" => "ErrorHeroModule\Handler\LoggingFactory"
      "SlmQueue\Job\JobPluginManager" => "SlmQueue\Factory\JobPluginManagerFactory"
      "SlmQueue\Strategy\StrategyPluginManager" => "SlmQueue\Factory\StrategyPluginManagerFactory"
      "SlmQueue\Queue\QueuePluginManager" => "SlmQueue\Factory\QueuePluginManagerFactory"
      "SlmQueue\Worker\WorkerPluginManager" => "SlmQueue\Factory\WorkerPluginManagerFactory"
      "SlmQueue\Command\StartWorkerCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
      "SlmQueueDoctrine\Command\RecoverJobsCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
    ]
    "aliases" => array:81 [
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "navigation" => "Laminas\Navigation\Navigation"
      "Zend\Navigation\Navigation" => "Laminas\Navigation\Navigation"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
      "ZF\Apigility\MvcAuth\UnauthenticatedListener" => "Laminas\ApiTools\MvcAuth\UnauthenticatedListener"
      "ZF\Apigility\MvcAuth\UnauthorizedListener" => "Laminas\ApiTools\MvcAuth\UnauthorizedListener"
      "ZF\Apigility\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\ApiFactory"
      "ZF\Apigility\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy"
      "Laminas\ApiTools\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "Laminas\ApiTools\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "Laminas\ApiTools\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "Laminas\ApiTools\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\ApiProblemListener"
      "ZF\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\RenderErrorListener"
      "ZF\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\ApiProblemRenderer"
      "ZF\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\ApiProblemStrategy"
      "ZF\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "ZF\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "ZF\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener"
      "ZF\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "ZF\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\ConfigResource"
      "ZF\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\ConfigResourceFactory"
      "ZF\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\ConfigWriter"
      "ZF\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\ModuleUtils"
      "Laminas\ApiTools\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId"
      "ZF\OAuth2\Adapter\PdoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
      "ZF\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter"
      "ZF\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\OAuth2\Service\OAuth2Server"
      "authentication" => "Laminas\ApiTools\MvcAuth\Authentication"
      "authorization" => "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface"
      "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface" => "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization"
      "ZF\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkExtractor"
      "ZF\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor"
      "ZF\Hal\HalConfig" => "Laminas\ApiTools\Hal\HalConfig"
      "ZF\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\JsonRenderer"
      "ZF\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\JsonStrategy"
      "ZF\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Link\LinkUrlBuilder"
      "ZF\Hal\MetadataMap" => "Laminas\ApiTools\Hal\MetadataMap"
      "ZF\Hal\RendererOptions" => "Laminas\ApiTools\Hal\RendererOptions"
      "ZF\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\AcceptListener"
      "ZF\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\ContentTypeListener"
      "ZF\Versioning\VersionListener" => "Laminas\ApiTools\Versioning\VersionListener"
      "mime_resolver" => "AssetManager\Service\MimeResolver"
      "AssetManager\Service\AggregateResolver" => "AssetManager\Resolver\AggregateResolver"
      "ZfcTwigExtension" => "ZfcTwig\Twig\Extension"
      "ZfcTwigLoaderChain" => "Twig\Loader\ChainLoader"
      "ZfcTwigLoaderTemplateMap" => "ZfcTwig\Twig\MapLoader"
      "ZfcTwigLoaderTemplatePathStack" => "ZfcTwig\Twig\StackLoader"
      "ZfcTwigRenderer" => "ZfcTwig\View\TwigRenderer"
      "ZfcTwigResolver" => "ZfcTwig\View\TwigResolver"
      "ZfcTwigViewHelperManager" => "ZfcTwig\View\HelperPluginManager"
      "ZfcTwigViewStrategy" => "ZfcTwig\View\TwigStrategy"
      "bjyauthorize_zend_db_adapter" => "Laminas\Db\Adapter\Adapter"
      "BjyAuthorize\Service\Authorize" => "Jield\Authorize\Service\AuthorizeService"
      "BjyAuthorize\Cache" => "Laminas\Cache\Storage\Adapter\Redis"
      "google-analytics" => "LaminasGoogleAnalytics\Analytics\Tracker"
      "google-analytics-universal" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "google-analytics-ga" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "delegators" => array:2 [
      "ViewHelperManager" => array:1 [ …1]
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => array:1 [ …1]
    ]
    "invokables" => array:44 [
      "Laminas\ApiTools\Rest\RestParametersListener" => "Laminas\ApiTools\Rest\Listener\RestParametersListener"
      "AssetManager\Service\MimeResolver" => "AssetManager\Service\MimeResolver"
      0 => "BjyAuthorize\View\RedirectionStrategy"
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
      "Content\InputFilter\ArticleFilter" => "Content\InputFilter\ArticleFilter"
      "Content\InputFilter\ContentFilter" => "Content\InputFilter\ContentFilter"
      "Content\InputFilter\ContentParamFilter" => "Content\InputFilter\ContentParamFilter"
      "Content\InputFilter\NodeFilter" => "Content\InputFilter\NodeFilter"
      "Content\InputFilter\ParamFilter" => "Content\InputFilter\ParamFilter"
      1 => "General\InputFilter\PasswordFilter"
      2 => "Cluster\Provider\ClusterProvider"
      3 => "News\InputFilter\NewsFilter"
      4 => "News\InputFilter\BlogFilter"
      5 => "News\InputFilter\Blog\MessageFilter"
      6 => "News\InputFilter\Magazine\ArticleFilter"
      7 => "Press\InputFilter\ArticleFilter"
      8 => "Press\InputFilter\BureauFilter"
      9 => "Program\InputFilter\Call\CallFilter"
      10 => "Program\InputFilter\Call\CountryFilter"
      11 => "Program\InputFilter\DoaFilter"
      12 => "Program\InputFilter\FunderFilter"
      13 => "Admin\InputFilter\Permit\RoleFilter"
      14 => "Organisation\InputFilter\NoteFilter"
      15 => "Invoice\InputFilter\InvoiceFilter"
      16 => "Invoice\InputFilter\RowFilter"
      "Calendar\InputFilter\CalendarFilter" => "Calendar\InputFilter\CalendarFilter"
      "Calendar\InputFilter\DocumentFilter" => "Calendar\InputFilter\DocumentFilter"
      "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "LaminasGoogleAnalytics\View\Helper\Script\Gajs" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "initializers" => array:1 [
      0 => "BjyAuthorize\Service\AuthorizeAwareServiceInitializer"
    ]
    "shared" => array:1 [
      "Contact\Service\ContactService" => false
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:15 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
      "cluster:update-project" => "Cluster\Command\UpdateProject"
      "cluster:generate-project-json" => "Cluster\Command\GenerateProjectJson"
      "contact:cleanup" => "Contact\Command\Cleanup"
      "contact:reset-access" => "Contact\Command\ResetAccess"
      "search:update-index" => "Search\Command\UpdateIndex"
      "organisation:cleanup" => "Organisation\Command\Cleanup"
      "invoice:sync" => "Invoice\Command\Sync"
      "invoice:daily-update" => "Invoice\Command\DailyUpdate"
      "event:update-registrations" => "Event\Command\UpdateRegistrations"
      "event:cancel-payment-pending" => "Event\Command\CancelPaymentPending"
      "mailing:send-queue" => "Mailing\Command\SendQueue"
      "mailing:flush-queue" => "Mailing\Command\FlushQueue"
      "slm-queue:start" => "SlmQueue\Command\StartWorkerCommand"
      "slm-queue:doctrine:recover" => "SlmQueueDoctrine\Command\RecoverJobsCommand"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:28 [
      "api-tools" => array:4 [ …4]
      "oauth" => array:4 [ …4]
      "api" => array:4 [ …4]
      "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
      "doctrine_orm_module_yuml" => array:2 [ …2]
      "zfcadmin" => array:5 [ …5]
      "home" => array:3 [ …3]
      "my" => array:3 [ …3]
      "redirect" => array:5 [ …5]
      "image" => array:4 [ …4]
      "country" => array:5 [ …5]
      "impact-stream" => array:5 [ …5]
      "challenge" => array:4 [ …4]
      "email" => array:5 [ …5]
      "community" => array:5 [ …5]
      "magazine" => array:4 [ …4]
      "annual-report" => array:4 [ …4]
      "json" => array:4 [ …4]
      "assets" => array:4 [ …4]
      "project" => array:5 [ …5]
      "press" => array:4 [ …4]
      "search" => array:3 [ …3]
      "oauth2" => array:4 [ …4]
      "user" => array:5 [ …5]
      "organisation" => array:5 [ …5]
      "publication" => array:5 [ …5]
      "deeplink" => array:3 [ …3]
      "error-preview" => array:2 [ …2]
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:504 [
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "agacceptheaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agcontenttypeheaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agservicepath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agstatuscodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agtransformdescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "agTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "ZF\Apigility\Documentation\View\AgAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "ZF\Apigility\Documentation\View\AgContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "ZF\Apigility\Documentation\View\AgServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "ZF\Apigility\Documentation\View\AgStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "ZF\Apigility\Documentation\View\AgTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "asset" => "AssetManager\View\Helper\Asset"
      "nodeLink" => "Content\View\Helper\NodeLink"
      "paramLink" => "Content\View\Helper\ParamLink"
      "handlerLink" => "Content\View\Helper\HandlerLink"
      "segmentLink" => "Content\View\Helper\SegmentLink"
      "templateLink" => "Content\View\Helper\TemplateLink"
      "contentLink" => "Content\View\Helper\ContentLink"
      "routeLink" => "Content\View\Helper\RouteLink"
      "topicLink" => "Content\View\Helper\TopicLink"
      "articleLink" => "Content\View\Helper\ArticleLink"
      "nodeTableRow" => "Content\View\Helper\NodeTableRow"
      "imageLink" => "Content\View\Helper\ImageLink"
      "image" => "Content\View\Helper\Image"
      "videoLink" => "Content\View\Helper\VideoLink"
      "video" => "Content\View\Helper\Video"
      "paginationLink" => "Content\View\Helper\PaginationLink"
      "imageHandler" => "Content\View\Handler\ImageHandler"
      "contentHandler" => "Content\View\Handler\ContentHandler"
      "buildNavigation" => "Content\View\Helper\BuildNavigation"
      "challengeHandler" => "General\View\Handler\ChallengeHandler"
      "challengeIcon" => "General\View\Helper\Challenge\ChallengeIcon"
      "challengeImage" => "General\View\Helper\Challenge\ChallengeImage"
      "challengeIdeaPosterImage" => "General\View\Helper\Challenge\Idea\Poster\Image"
      "challengeIdeaPosterIcon" => "General\View\Helper\Challenge\Idea\Poster\Icon"
      "challengeTypeLink" => "General\View\Helper\Challenge\TypeLink"
      "countryMap" => "General\View\Helper\Country\CountryMap"
      "countryFlag" => "General\View\Helper\Country\CountryFlag"
      "countryLink" => "General\View\Helper\Country\CountryLink"
      "countryVideoLink" => "General\View\Helper\Country\VideoLink"
      "languageLink" => "General\View\Helper\LanguageLink"
      "currencyLink" => "General\View\Helper\CurrencyLink"
      "exchangeRateLink" => "General\View\Helper\ExchangeRateLink"
      "passwordLink" => "General\View\Helper\PasswordLink"
      "emailMessageLink" => "General\View\Helper\EmailMessageLink"
      "generalLogLink" => "General\View\Helper\LogLink"
      "vatLink" => "General\View\Helper\VatLink"
      "genderLink" => "General\View\Helper\GenderLink"
      "titleLink" => "General\View\Helper\TitleLink"
      "vatTypeLink" => "General\View\Helper\VatTypeLink"
      "challengeLink" => "General\View\Helper\Challenge\ChallengeLink"
      "webInfoLink" => "General\View\Helper\WebInfoLink"
      "contentTypeLink" => "General\View\Helper\ContentTypeLink"
      "contentTypeIcon" => "General\View\Helper\ContentTypeIcon"
      "countryselect" => "General\Form\View\Helper\CountrySelect"
      "clusterLink" => "Cluster\View\Helper\ClusterLink"
      "clusterLogo" => "Cluster\View\Helper\Cluster\Logo"
      "blogLink" => "News\View\Helper\BlogLink"
      "blogMessageLink" => "News\View\Helper\Blog\MessageLink"
      "blogTagLink" => "News\View\Helper\Blog\TagLink"
      "blogCategoryLink" => "News\View\Helper\Blog\CategoryLink"
      "newsLink" => "News\View\Helper\NewsLink"
      "newsCategoryLink" => "News\View\Helper\News\CategoryLink"
      "magazineLink" => "News\View\Helper\MagazineLink"
      "magazineArticleLink" => "News\View\Helper\Magazine\ArticleLink"
      "blogselect" => "News\Form\View\Helper\BlogSelect"
      "contactLink" => "Contact\View\Helper\ContactLink"
      "officeContactLink" => "Contact\View\Helper\Office\ContactLink"
      "leaveLink" => "Contact\View\Helper\Office\LeaveLink"
      "dndLink" => "Contact\View\Helper\DndLink"
      "profileLink" => "Contact\View\Helper\ProfileLink"
      "selectionLink" => "Contact\View\Helper\SelectionLink"
      "selectionTypeLink" => "Contact\View\Helper\Selection\TypeLink"
      "facebookLink" => "Contact\View\Helper\FacebookLink"
      "optInLink" => "Contact\View\Helper\OptInLink"
      "addressLink" => "Contact\View\Helper\AddressLink"
      "noteLink" => "Contact\View\Helper\NoteLink"
      "phoneLink" => "Contact\View\Helper\PhoneLink"
      "contactPhoto" => "Contact\View\Helper\ContactPhoto"
      "contactformelement" => "Contact\Form\View\Helper\ContactFormElement"
      "selectionformelement" => "Contact\Form\View\Helper\SelectionFormElement"
      "qualityActionLink" => "Quality\View\Helper\ActionLink"
      "qualityProcessLink" => "Quality\View\Helper\ProcessLink"
      "qualityStatusLink" => "Quality\View\Helper\StatusLink"
      "qualityStatusBadge" => "Quality\View\Helper\StatusBadge"
      "qualityPhaseLink" => "Quality\View\Helper\PhaseLink"
      "qualityYearLink" => "Quality\View\Helper\YearLink"
      "qualityTargetLink" => "Quality\View\Helper\TargetLink"
      "qualityKpiLink" => "Quality\View\Helper\KpiLink"
      "qualityKpiTargetLink" => "Quality\View\Helper\Kpi\TargetLink"
      "qualityKpiGroupLink" => "Quality\View\Helper\Kpi\GroupLink"
      "qualityKpiResultLink" => "Quality\View\Helper\Kpi\ResultLink"
      "qualityKpiResultMatrix" => "Quality\View\Helper\Kpi\Result\Matrix"
      "qualityActionSourceLink" => "Quality\View\Helper\Action\SourceLink"
      "qualityActionGroupLink" => "Quality\View\Helper\Action\GroupLink"
      "qualityActionResultMatrix" => "Quality\View\Helper\Action\Result\Matrix"
      "projectLogo" => "Project\View\Helper\Project\ProjectLogo"
      "projectQuickstart" => "Project\View\Helper\Project\Quickstart"
      "projectStatusIcon" => "Project\View\Helper\Project\StatusIcon"
      "projectDates" => "Project\View\Helper\Project\ProjectDates"
      "projectInviteLink" => "Project\View\Helper\Project\InviteLink"
      "projectSelectionLink" => "Project\View\Helper\SelectionLink"
      "ideaImage" => "Project\View\Helper\Idea\IdeaImage"
      "toolSessionLink" => "Project\View\Helper\Idea\Tool\SessionLink"
      "helpLink" => "Project\View\Helper\HelpLink"
      "logLink" => "Project\View\Helper\LogLink"
      "pcaLink" => "Project\View\Helper\PcaLink"
      "helpFaqLink" => "Project\View\Helper\HelpFaqLink"
      "projectLink" => "Project\View\Helper\Project\ProjectLink"
      "documentLink" => "Project\View\Helper\Document\DocumentLink"
      "documentTypeLink" => "Project\View\Helper\Document\TypeLink"
      "versionLink" => "Project\View\Helper\Version\VersionLink"
      "versionDocumentLink" => "Project\View\Helper\Version\DocumentLink"
      "versionReviewerLink" => "Project\View\Helper\Version\ReviewerLink"
      "resultCategoryLink" => "Project\View\Helper\Result\CategoryLink"
      "resultTypeLink" => "Project\View\Helper\Result\TypeLink"
      "resultLink" => "Project\View\Helper\ResultLink"
      "reportLink" => "Project\View\Helper\Report\ReportLink"
      "reportHelper" => "Project\View\Helper\Report\ReportHelper"
      "reportItemLink" => "Project\View\Helper\Report\ItemLink"
      "reportReviewerLink" => "Project\View\Helper\Report\ReviewerLink"
      "projectReportWindowLink" => "Project\View\Helper\Report\WindowLink"
      "projectReportWindowProjectLink" => "Project\View\Helper\Report\Window\ProjectLink"
      "reportWorkpackageDescriptionLink" => "Project\View\Helper\Report\WorkpackageDescriptionLink"
      "workpackageLink" => "Project\View\Helper\Workpackage\WorkpackageLink"
      "workpackageDocumentLink" => "Project\View\Helper\Workpackage\DocumentLink"
      "workpackageTaskLink" => "Project\View\Helper\Workpackage\TaskLink"
      "workpackageDeliverableLink" => "Project\View\Helper\Workpackage\DeliverableLink"
      "workpackageDescriptionLink" => "Project\View\Helper\Workpackage\DescriptionLink"
      "workpackageDeliverableDocumentLink" => "Project\View\Helper\Workpackage\Deliverable\DocumentLink"
      "workpackageDeliverableTypeLink" => "Project\View\Helper\Workpackage\Deliverable\TypeLink"
      "posterLink" => "Project\View\Helper\PosterLink"
      "feeLink" => "Project\View\Helper\FeeLink"
      "ideaLink" => "Project\View\Helper\Idea\IdeaLink"
      "ideaToolLink" => "Project\View\Helper\Idea\ToolLink"
      "ideaInviteLink" => "Project\View\Helper\Idea\InviteLink"
      "ideaDescriptionLink" => "Project\View\Helper\Idea\DescriptionLink"
      "ideaPartnerLink" => "Project\View\Helper\Idea\PartnerLink"
      "ideaPosterLink" => "Project\View\Helper\Idea\PosterLink"
      "ideaPosterAttachment" => "Project\View\Helper\Idea\Poster\Attachment"
      "ideaPosterThumbnail" => "Project\View\Helper\Idea\Poster\Thumbnail"
      "ideaDocumentLink" => "Project\View\Helper\Idea\DocumentLink"
      "ideaImageLink" => "Project\View\Helper\Idea\ImageLink"
      "ideaVideoLink" => "Project\View\Helper\Idea\VideoLink"
      "ideaMeetingLink" => "Project\View\Helper\Idea\MeetingLink"
      "ideaMeetingInviteLink" => "Project\View\Helper\Idea\Meeting\InviteLink"
      "ideaMessageLink" => "Project\View\Helper\Idea\MessageLink"
      "ideaMessageDocumentLink" => "Project\View\Helper\Idea\Message\DocumentLink"
      "ideaStatusLink" => "Project\View\Helper\Idea\StatusLink"
      "ideaStatusDocumentLink" => "Project\View\Helper\Idea\Status\DocumentLink"
      "ideaDescriptionTypeLink" => "Project\View\Helper\Idea\Description\TypeLink"
      "buildHelp" => "Project\View\Helper\BuildHelp"
      "descriptionLink" => "Project\View\Helper\DescriptionLink"
      "buildDescription" => "Project\View\Helper\Description\BuildTree"
      "buildDescriptionNavigation" => "Project\View\Helper\Description\BuildNavigation"
      "buildDescriptionContent" => "Project\View\Helper\Description\BuildContent"
      "rationaleLink" => "Project\View\Helper\RationaleLink"
      "achievementLink" => "Project\View\Helper\Achievement\AchievementLink"
      "achievementTypeLink" => "Project\View\Helper\Achievement\TypeLink"
      "achievementCategoryLink" => "Project\View\Helper\Achievement\CategoryLink"
      "achievementExploitableResultLink" => "Project\View\Helper\Achievement\ExploitableResultLink"
      "achievementExploitableResultLinkLink" => "Project\View\Helper\Achievement\ExploitableResult\LinkLink"
      "achievementExploitableResultDocumentLink" => "Project\View\Helper\Achievement\ExploitableResult\DocumentLink"
      "changeRequestProcessLink" => "Project\View\Helper\ChangeRequest\ProcessLink"
      "changeRequestCostChangeLink" => "Project\View\Helper\ChangeRequest\CostChangeLink"
      "changeRequestCountryLink" => "Project\View\Helper\ChangeRequest\CountryLink"
      "projectCalendarReviewerLink" => "Project\View\Helper\Project\CalendarReviewerLink"
      "projectContractLink" => "Project\View\Helper\Contract\ContractLink"
      "contractDocumentLink" => "Project\View\Helper\Contract\DocumentLink"
      "contractVersionLink" => "Project\View\Helper\Contract\VersionLink"
      "contractVersionDocumentLink" => "Project\View\Helper\Contract\VersionDocumentLink"
      "actionLink" => "Project\View\Helper\Action\ActionLink"
      "actionTypeLink" => "Project\View\Helper\Action\TypeLink"
      "awardLink" => "Project\View\Helper\Award\AwardLink"
      "awardTypeLink" => "Project\View\Helper\Award\TypeLink"
      "eventLink" => "Project\View\Helper\EventLink"
      "eventTypeLink" => "Project\View\Helper\EventTypeLink"
      "projectformelement" => "Project\Form\View\Helper\ProjectFormElement"
      "resultselect" => "Project\Form\View\Helper\ResultSelect"
      "feedbackLink" => "Evaluation\View\Helper\FeedbackLink"
      "evaluationLink" => "Evaluation\View\Helper\EvaluationLink"
      "evaluationReportLink" => "Evaluation\View\Helper\ReportLink"
      "evaluationReportDownloadLink" => "Evaluation\View\Helper\Report\DownloadLink"
      "evaluationReportPresentationLink" => "Evaluation\View\Helper\Report\PresentationLink"
      "evaluationReportFinalLink" => "Evaluation\View\Helper\Report\FinalLink"
      "evaluationReportProgress" => "Evaluation\View\Helper\Report\Progress"
      "evaluationReportScore" => "Evaluation\View\Helper\Report\Score"
      "reportVersionLink" => "Evaluation\View\Helper\Report\VersionLink"
      "reportWindowLink" => "Evaluation\View\Helper\Report\WindowLink"
      "reportCriterionLink" => "Evaluation\View\Helper\Report\CriterionLink"
      "reportCriterionCategoryLink" => "Evaluation\View\Helper\Report\Criterion\CategoryLink"
      "reportCriterionTypeLink" => "Evaluation\View\Helper\Report\Criterion\TypeLink"
      "reportCriterionTopicLink" => "Evaluation\View\Helper\Report\Criterion\TopicLink"
      "reportCriterionVersionLink" => "Evaluation\View\Helper\Report\Criterion\VersionLink"
      "reviewerLink" => "Evaluation\View\Helper\ReviewerLink"
      "reviewerContactLink" => "Evaluation\View\Helper\Reviewer\ContactLink"
      "pressArticleLink" => "Press\View\Helper\ArticleLink"
      "bureauLink" => "Press\View\Helper\BureauLink"
      "programHandler" => "Program\View\Handler\ProgramHandler"
      "callInformationBox" => "Program\View\Helper\CallInformationBox"
      "programLink" => "Program\View\Helper\ProgramLink"
      "programDoaLink" => "Program\View\Helper\DoaLink"
      "callLink" => "Program\View\Helper\CallLink"
      "ndaLink" => "Program\View\Helper\NdaLink"
      "funderLink" => "Program\View\Helper\FunderLink"
      "callCountryLink" => "Program\View\Helper\CallCountryLink"
      "accessLink" => "Admin\View\Helper\AccessLink"
      "permitEntityLink" => "Admin\View\Helper\Permit\EntityLink"
      "permitRoleLink" => "Admin\View\Helper\Permit\RoleLink"
      "permitSetterLink" => "Admin\View\Helper\Permit\SetterLink"
      "queueLink" => "Admin\View\Helper\QueueLink"
      "oauth2clientlink" => "Admin\View\Helper\OAuth2\ClientLink"
      "oauth2scopelink" => "Admin\View\Helper\OAuth2\ScopeLink"
      "apiLogLink" => "Admin\View\Helper\Api\LogLink"
      "accessformelement" => "Admin\Form\View\Helper\AccessFormElement"
      "ztbalert" => "lbs5alert"
      "ztbformelement" => "lbs5formelement"
      "filterbarelement" => "lbs5filterbarelement"
      "lbs5navigation" => "LaminasBootstrap5\View\Helper\Navigation"
      "lbs5filterbarelement" => "LaminasBootstrap5\Form\View\Helper\FilterBarElement"
      "lbs5filtercolumnelement" => "LaminasBootstrap5\Form\View\Helper\FilterColumnElement"
      "lbs5formelement" => "LaminasBootstrap5\Form\View\Helper\FormElement"
      "lbs5formcheckbox" => "LaminasBootstrap5\Form\View\Helper\FormCheckbox"
      "associateLink" => "Affiliation\View\Helper\AssociateLink"
      "affiliationLink" => "Affiliation\View\Helper\AffiliationLink"
      "affiliationDoaLink" => "Affiliation\View\Helper\DoaLink"
      "affiliationLoiLink" => "Affiliation\View\Helper\LoiLink"
      "paymentSheet" => "Affiliation\View\Helper\PaymentSheet"
      "affiliationEffortSpentLink" => "Affiliation\View\Helper\EffortSpentLink"
      "affiliationQuestionCategoryLink" => "Affiliation\View\Helper\Questionnaire\CategoryLink"
      "affiliationQuestionLink" => "Affiliation\View\Helper\Questionnaire\QuestionLink"
      "affiliationQuestionnaireLink" => "Affiliation\View\Helper\Questionnaire\QuestionnaireLink"
      "questionnaireHelper" => "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper"
      "organisationLink" => "Organisation\View\Helper\OrganisationLink"
      "organisationTypeLink" => "Organisation\View\Helper\Organisation\TypeLink"
      "organisationLogo" => "Organisation\View\Helper\OrganisationLogo"
      "organisationNoteLink" => "Organisation\View\Helper\NoteLink"
      "boardLink" => "Organisation\View\Helper\BoardLink"
      "organisationSelectionLink" => "Organisation\View\Helper\SelectionLink"
      "parentLink" => "Organisation\View\Helper\Parent\ParentLink"
      "parentOrganisationLink" => "Organisation\View\Helper\Parent\OrganisationLink"
      "parentDoaLink" => "Organisation\View\Helper\Parent\DoaLink"
      "parentTypeLink" => "Organisation\View\Helper\Parent\TypeLink"
      "parentFinancialLink" => "Organisation\View\Helper\Parent\FinancialLink"
      "advisoryBoardCityLink" => "Organisation\View\Helper\AdvisoryBoard\CityLink"
      "advisoryBoardCityImage" => "Organisation\View\Helper\AdvisoryBoard\CityImage"
      "advisoryBoardSolutionLink" => "Organisation\View\Helper\AdvisoryBoard\SolutionLink"
      "advisoryBoardSolutionImage" => "Organisation\View\Helper\AdvisoryBoard\SolutionImage"
      "organisationUpdateLink" => "Organisation\View\Helper\UpdateLink"
      "organisationUpdateLogo" => "Organisation\View\Helper\UpdateLogo"
      "organisationUpdateNotification" => "Organisation\View\Helper\UpdateNotification"
      "overviewVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution"
      "overviewExtraVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution"
      "organisationselect" => "Organisation\Form\View\Helper\OrganisationFormElement"
      "parentformelement" => "Organisation\Form\View\Helper\ParentFormElement"
      "publicationLink" => "Publication\View\Helper\PublicationLink"
      "publicationTypeLink" => "Publication\View\Helper\TypeLink"
      "publicationCategoryLink" => "Publication\View\Helper\CategoryLink"
      "invoiceLink" => "Invoice\View\Helper\InvoiceLink"
      "transactionLink" => "Invoice\View\Helper\TransactionLink"
      "invoiceRowLink" => "Invoice\View\Helper\RowLink"
      "dimensionLink" => "Invoice\View\Helper\DimensionLink"
      "invoicePdfLink" => "Invoice\View\Helper\PdfLink"
      "invoiceWordLink" => "Invoice\View\Helper\WordLink"
      "reminderLink" => "Invoice\View\Helper\ReminderLink"
      "reminderInvoiceOverview" => "Invoice\View\Helper\ReminderInvoiceOverview"
      "journalLink" => "Invoice\View\Helper\JournalLink"
      "dailyUpdateHandler" => "Invoice\View\Helper\DailyUpdateHandler"
      "canAssemble" => "Deeplink\View\Helper\CanAssemble"
      "deeplinkLink" => "Deeplink\View\Helper\DeeplinkLink"
      "deeplinkTargetLink" => "Deeplink\View\Helper\Deeplink\TargetLink"
      "deskCostsLink" => "Event\View\Helper\DeskCostsLink"
      "meetingLink" => "Event\View\Helper\Meeting\MeetingLink"
      "meetingOptionLink" => "Event\View\Helper\Meeting\OptionLink"
      "meetingOptionCostLink" => "Event\View\Helper\Meeting\OptionCostLink"
      "meetingCostLink" => "Event\View\Helper\Meeting\CostLink"
      "meetingQuotaLink" => "Event\View\Helper\Meeting\QuotaLink"
      "meetingCouponLink" => "Event\View\Helper\CouponLink"
      "boothLink" => "Event\View\Helper\Booth\BoothLink"
      "boothSpecLink" => "Event\View\Helper\Booth\SpecLink"
      "exhibitionLink" => "Event\View\Helper\Exhibition\ExhibitionLink"
      "registrationLink" => "Event\View\Helper\RegistrationLink"
      "meetingFloorplanLink" => "Event\View\Helper\Meeting\FloorplanLink"
      "exhibitionSpecLink" => "Event\View\Helper\Exhibition\SpecLink"
      "exhibitionCostLink" => "Event\View\Helper\Exhibition\CostLink"
      "badgeLink" => "Event\View\Helper\Badge\BadgeLink"
      "badgeAttachmentLink" => "Event\View\Helper\Badge\AttachmentLink"
      "badgeImage" => "Event\View\Helper\Badge\Image"
      "badgeContactLink" => "Event\View\Helper\Badge\ContactLink"
      "ticketImage" => "Event\View\Helper\Ticket\Image"
      "ticketLink" => "Event\View\Helper\Ticket\TicketLink"
      "calendarDocumentLink" => "Calendar\View\Helper\DocumentLink"
      "calendarTypeLink" => "Calendar\View\Helper\TypeLink"
      "calendarLink" => "Calendar\View\Helper\CalendarLink"
      "mailingLink" => "Mailing\View\Helper\MailingLink"
      "attachmentLink" => "Mailing\View\Helper\AttachmentLink"
      "mailingContactLink" => "Mailing\View\Helper\MailingContactLink"
      "mailingTemplateLink" => "Mailing\View\Helper\TemplateLink"
      "senderLink" => "Mailing\View\Helper\SenderLink"
      "emailMessageEventIcon" => "Mailing\View\Helper\EmailMessageEventIcon"
    ]
    "factories" => array:348 [
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\ApiTools\Documentation\View\AgAcceptHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgServicePath" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgStatusCodes" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgTransformDescription" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Hal" => "Laminas\ApiTools\Hal\Factory\HalViewHelperFactory"
      "AssetManager\View\Helper\Asset" => "AssetManager\Service\AssetViewHelperFactory"
      "isAllowed" => "BjyAuthorize\View\Helper\IsAllowedFactory"
      "Content\View\Helper\NodeLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ParamLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\HandlerLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\SegmentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TemplateLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ContentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\RouteLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TopicLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Image" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Video" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\NodeTableRow" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ImageHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ArticleHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ContentHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\PaginationLink" => "Application\Factory\InvokableFactory"
      "Content\View\Helper\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\ChallengeIcon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\ChallengeImage" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Image" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Icon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Country\CountryFlag" => "General\View\Factory\ImageHelperFactory"
      "General\View\Handler\CountryHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ImpactStreamHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ChallengeHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Challenge\ChallengeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\CurrencyLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ExchangeRateLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\PasswordLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LanguageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\GenderLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\EmailMessageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\TitleLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\WebInfoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ContentTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryMap" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\ContentTypeIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\View\Helper\ClusterLink" => "General\View\Factory\LinkHelperFactory"
      "Cluster\View\Helper\Cluster\Logo" => "General\View\Factory\ImageHelperFactory"
      "News\View\Handler\NewsHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\BlogHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\MagazineHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Helper\BlogLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\TagLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\NewsLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\News\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\MagazineLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Magazine\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\DndLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ProfileLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Selection\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\FacebookLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\OptInLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\AddressLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\NoteLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\PhoneLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactPhoto" => "General\View\Factory\ImageHelperFactory"
      "Contact\View\Helper\Office\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Office\LeaveLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\Form\View\Helper\ContactFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\View\Helper\SelectionFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusBadge" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Quality\View\Helper\PhaseLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\YearLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\KpiLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\Action\SourceLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\View\Helper\ProjectFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ProjectHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ResultHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\IdeaHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectLogo" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Project\Quickstart" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\StatusIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectDates" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaImage" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PcaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpFaqLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\VersionLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Version\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportHelper" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Report\ItemLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\Window\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WorkpackageDescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\WorkpackageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\TaskLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DeliverableLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\FeeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ToolLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PartnerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Description\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MeetingLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Meeting\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Message\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Status\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Poster\Attachment" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Poster\Thumbnail" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Tool\SessionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\BuildHelp" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Description\BuildTree" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildContent" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\RationaleLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\AchievementLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\LinkLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CostChangeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\CalendarReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\ContractLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionDocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\AwardLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventTypeLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\FeedbackLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\EvaluationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\DownloadLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\PresentationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\FinalLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Progress" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\Score" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\CriterionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Criterion\CategoryLink" => "General\View\Factory\LinkHelperFactory"
       …109
    ]
    "invokables" => array:18 [ …18]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:2 [ …2]
  ]
  "controller_plugins" => array:3 [
    "aliases" => array:100 [ …100]
    "factories" => array:89 [ …89]
    "invokables" => array:2 [ …2]
  ]
  "asset_manager" => array:6 [
    "resolver_configs" => array:4 [ …4]
    "clear_output_buffer" => true
    "resolvers" => array:6 [ …6]
    "view_helper" => array:3 [ …3]
    "caching" => array:4 [ …4]
    "filters" => array:2 [ …2]
  ]
  "api-tools" => array:1 [
    "db-connected" => []
  ]
  "controllers" => array:4 [
    "aliases" => array:3 [ …3]
    "factories" => array:330 [ …330]
    "abstract_factories" => array:2 [ …2]
    "invokables" => array:3 [ …3]
  ]
  "api-tools-content-negotiation" => array:6 [
    "controllers" => array:2 [ …2]
    "accept_whitelist" => array:1 [ …1]
    "selectors" => array:3 [ …3]
    "content_type_whitelist" => []
    "x_http_method_override_enabled" => false
    "http_override_methods" => []
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:5 [ …5]
    "display_exceptions" => true
    "template_map" => array:1497 [ …1497]
    "strategies" => array:2 [ …2]
    "display_not_found_reason" => true
    "doctype" => "HTML5"
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
  ]
  "api-tools-api-problem" => []
  "api-tools-configuration" => array:1 [
    "config_file" => "config/autoload/development.php"
  ]
  "api-tools-oauth2" => array:7 [
    "grant_types" => array:5 [ …5]
    "api_problem_error_response" => true
    "storage" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
    "options" => array:6 [ …6]
    "allow_implicit" => true
    "access_lifetime" => 3600
    "enforce_state" => true
  ]
  "api-tools-mvc-auth" => array:2 [
    "authentication" => array:2 [ …2]
    "authorization" => array:2 [ …2]
  ]
  "api-tools-hal" => array:3 [
    "renderer" => []
    "metadata_map" => []
    "options" => array:1 [ …1]
  ]
  "filters" => array:1 [
    "factories" => array:2 [ …2]
  ]
  "validators" => array:2 [
    "factories" => array:8 [ …8]
    "aliases" => array:3 [ …3]
  ]
  "input_filter_specs" => []
  "api-tools-content-validation" => array:1 [
    "methods_without_bodies" => []
  ]
  "api-tools-rest" => array:1 [
    "Api\V1\Rest\ContactResource\MeListener" => array:11 [ …11]
  ]
  "api-tools-rpc" => []
  "api-tools-versioning" => array:3 [
    "content-type" => []
    "default_version" => 1
    "uri" => []
  ]
  "bjyauthorize" => array:12 [
    "guards" => array:1 [ …1]
    "default_role" => "guest"
    "authenticated_role" => "user"
    "identity_provider" => "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider"
    "role_providers" => array:1 [ …1]
    "resource_providers" => []
    "rule_providers" => []
    "unauthorized_strategy" => "Jield\Authorize\View\UnauthorizedStrategy"
    "template" => "error/403"
    "cache_enabled" => true
    "cache_options" => array:2 [ …2]
    "cache_key" => "bjyauthorize_acl"
  ]
  "doctrine" => array:15 [
    "driver" => array:22 [ …22]
    "cache" => array:11 [ …11]
    "authentication" => array:2 [ …2]
    "authenticationadapter" => array:2 [ …2]
    "authenticationstorage" => array:2 [ …2]
    "authenticationservice" => array:2 [ …2]
    "connection" => array:1 [ …1]
    "configuration" => array:1 [ …1]
    "entitymanager" => array:1 [ …1]
    "eventmanager" => array:1 [ …1]
    "sql_logger_collector" => array:1 [ …1]
    "mapping_collector" => array:1 [ …1]
    "entity_resolver" => array:1 [ …1]
    "migrations_configuration" => array:1 [ …1]
    "migrations_cmd" => array:13 [ …13]
  ]
  "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory" => array:608 [
    "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
    "Jield\Authorize\View\UnauthorizedStrategy" => array:2 [ …2]
    "Application\Twig\DatabaseTwigLoader" => array:1 [ …1]
    "Application\Event\SetTitle" => array:2 [ …2]
    "Application\Event\InjectAclInNavigation" => array:2 [ …2]
    "Application\Event\BlockInactiveContact" => array:1 [ …1]
    "Application\Event\RegisterPageview" => array:3 [ …3]
    "Application\Authentication\Storage\AuthenticationStorage" => array:2 [ …2]
    "Laminas\Authentication\AuthenticationService" => array:1 [ …1]
    "Application\Session\SaveHandler\DoctrineGateway" => array:2 [ …2]
    "Content\Controller\Json\ArticleController" => array:1 [ …1]
    "Content\Controller\Json\ImageController" => array:3 [ …3]
    "Content\Controller\Json\NodeController" => array:3 [ …3]
    "Content\Controller\ArticleController" => array:4 [ …4]
    "Content\Controller\ContentController" => array:1 [ …1]
    "Content\Controller\ImageController" => array:4 [ …4]
    "Content\Controller\VideoController" => array:4 [ …4]
    "Content\Controller\NodeController" => array:3 [ …3]
    "Content\Controller\NodeManagerController" => array:4 [ …4]
    "Content\Controller\RedirectController" => array:3 [ …3]
    "Content\Navigation\Service\ContentNavigationService" => array:7 [ …7]
    "Content\InputFilter\HandlerFilter" => array:1 [ …1]
    "Content\InputFilter\RouteFilter" => array:1 [ …1]
    "Content\InputFilter\SegmentFilter" => array:1 [ …1]
    "Content\InputFilter\TemplateFilter" => array:1 [ …1]
    "Content\InputFilter\TopicFilter" => array:1 [ …1]
    "Content\Service\ArticleService" => array:1 [ …1]
    "Content\Service\VimeoService" => array:2 [ …2]
    "Content\Service\RouteService" => array:1 [ …1]
    "Content\Service\ContentService" => array:1 [ …1]
    "Content\Service\NodeService" => array:2 [ …2]
    "Content\View\Helper\BuildNavigation" => array:3 [ …3]
    "Content\View\Helper\NodeTableRow" => array:2 [ …2]
    "Content\View\Helper\Image" => array:3 [ …3]
    "Content\View\Handler\ArticleHandler" => array:8 [ …8]
    "Content\View\Handler\ContentHandler" => array:8 [ …8]
    "Content\View\Handler\ImageHandler" => array:8 [ …8]
    "General\Controller\ChallengeController" => array:4 [ …4]
    "General\Controller\ChallengeTypeController" => array:3 [ …3]
    "General\Controller\ContentTypeController" => array:3 [ …3]
    "General\Controller\LanguageController" => array:3 [ …3]
    "General\Controller\CountryController" => array:4 [ …4]
    "General\Controller\Country\VideoController" => array:3 [ …3]
    "General\Controller\CurrencyController" => array:3 [ …3]
    "General\Controller\EmailController" => array:2 [ …2]
    "General\Controller\ExchangeRateController" => array:3 [ …3]
    "General\Controller\GenderController" => array:3 [ …3]
    "General\Controller\ImageController" => array:2 [ …2]
    "General\Controller\ImpactStreamController" => array:3 [ …3]
    "General\Controller\LogController" => array:3 [ …3]
    "General\Controller\PasswordController" => array:3 [ …3]
    "General\Controller\TitleController" => array:3 [ …3]
    "General\Controller\VatController" => array:3 [ …3]
    "General\Controller\VatTypeController" => array:3 [ …3]
    "General\Controller\WebInfoController" => array:4 [ …4]
    "General\Service\GeneralService" => array:1 [ …1]
    "General\Service\CountryService" => array:3 [ …3]
    "General\View\Handler\ImpactStreamHandler" => array:9 [ …9]
    "General\View\Handler\ChallengeHandler" => array:7 [ …7]
    "General\View\Handler\CountryHandler" => array:9 [ …9]
    "General\View\Helper\ContentTypeIcon" => array:1 [ …1]
    "General\View\Helper\Country\CountryMap" => array:2 [ …2]
    "General\Search\Service\CountrySearchService" => array:1 [ …1]
    "Cluster\Command\UpdateProject" => array:4 [ …4]
    "Cluster\Command\GenerateProjectJson" => array:2 [ …2]
    "Cluster\Controller\Admin\ClusterController" => array:4 [ …4]
    "Cluster\Controller\ImageController" => array:1 [ …1]
    "Cluster\Service\ClusterService" => array:1 [ …1]
    "Cluster\Service\StatisticsService" => array:1 [ …1]
    "Cluster\Form\ClusterForm" => array:1 [ …1]
    "News\Controller\BlogController" => array:4 [ …4]
    "News\Controller\Blog\CategoryController" => array:3 [ …3]
    "News\Controller\Blog\TagController" => array:3 [ …3]
    "News\Controller\Blog\MessageController" => array:3 [ …3]
    "News\Controller\NewsController" => array:4 [ …4]
    "News\Controller\News\CategoryController" => array:3 [ …3]
    "News\Controller\MagazineController" => array:4 [ …4]
    "News\Controller\Magazine\ArticleController" => array:4 [ …4]
    "News\Service\BlogService" => array:4 [ …4]
    "News\Service\NewsService" => array:3 [ …3]
    "News\Service\MagazineService" => array:1 [ …1]
    "News\Search\Service\NewsSearchService" => array:1 [ …1]
    "News\Search\Service\BlogSearchService" => array:1 [ …1]
    "News\View\Handler\NewsHandler" => array:7 [ …7]
    "News\View\Handler\BlogHandler" => array:7 [ …7]
    "News\View\Handler\MagazineHandler" => array:6 [ …6]
    "Contact\Controller\AddressManagerController" => array:3 [ …3]
    "Contact\Controller\ContactAdminController" => array:12 [ …12]
    "Contact\Controller\ContactDetailsController" => array:10 [ …10]
    "Contact\Controller\ContactController" => array:3 [ …3]
    "Contact\Controller\DndController" => array:5 [ …5]
    "Contact\Controller\FacebookController" => array:3 [ …3]
    "Contact\Controller\FacebookManagerController" => array:3 [ …3]
    "Contact\Controller\OptInManagerController" => array:3 [ …3]
    "Contact\Controller\ImageController" => array:1 [ …1]
    "Contact\Controller\NoteManagerController" => array:3 [ …3]
    "Contact\Controller\PhoneManagerController" => array:3 [ …3]
    "Contact\Controller\ProfileController" => array:10 [ …10]
    "Contact\Controller\Selection\ManagerController" => array:7 [ …7]
    "Contact\Controller\Selection\TypeController" => array:3 [ …3]
    "Contact\Controller\Office\ContactController" => array:2 [ …2]
    "Contact\Controller\Office\LeaveController" => array:3 [ …3]
    "Contact\Command\Cleanup" => array:1 [ …1]
    "Contact\Command\ResetAccess" => array:1 [ …1]
    "Contact\Provider\ContactProvider" => array:1 [ …1]
    "Contact\Controller\Plugin\MergeContact" => array:3 [ …3]
    "Contact\Controller\Plugin\ContactActions" => array:3 [ …3]
    "Contact\Controller\Plugin\HandleImport" => array:6 [ …6]
    "Contact\Controller\Plugin\SelectionExport" => array:4 [ …4]
    "Contact\Search\Service\ContactSearchService" => array:1 [ …1]
    "Contact\Search\Service\ProfileSearchService" => array:1 [ …1]
    "Contact\Form\ContactForm" => array:1 [ …1]
    "Contact\Form\View\Helper\ContactFormElement" => array:3 [ …3]
    "Contact\Form\View\Helper\SelectionFormElement" => array:2 [ …2]
    "Contact\Service\AddressService" => array:1 [ …1]
    "Contact\Service\ContactService" => array:9 [ …9]
    "Contact\Service\SelectionContactService" => array:1 [ …1]
    "Contact\Service\SelectionService" => array:3 [ …3]
    "Contact\Service\Office\ContactService" => array:1 [ …1]
    "Quality\Controller\IndexController" => array:1 [ …1]
    "Quality\Controller\ProcessController" => array:2 [ …2]
    "Quality\Controller\PhaseController" => array:2 [ …2]
    "Quality\Controller\StatusController" => array:2 [ …2]
    "Quality\Controller\YearController" => array:2 [ …2]
    "Quality\Controller\ActionController" => array:2 [ …2]
    "Quality\Controller\TargetController" => array:2 [ …2]
    "Quality\Controller\KpiController" => array:2 [ …2]
    "Quality\Controller\Kpi\TargetController" => array:2 [ …2]
    "Quality\Controller\Kpi\GroupController" => array:2 [ …2]
    "Quality\Controller\Kpi\ResultController" => array:2 [ …2]
    "Quality\Controller\Kpi\Result\MatrixController" => array:1 [ …1]
    "Quality\Controller\Kpi\ActionController" => array:1 [ …1]
    "Quality\Controller\Action\SourceController" => array:2 [ …2]
    "Quality\Controller\Action\GroupController" => array:2 [ …2]
    "Quality\Controller\Action\ResultController" => array:2 [ …2]
    "Quality\Controller\Action\Result\MatrixController" => array:2 [ …2]
    "Quality\Service\QualityService" => array:2 [ …2]
    "Quality\View\Helper\Kpi\Result\Matrix" => array:2 [ …2]
    "Quality\View\Helper\Action\Result\Matrix" => array:2 [ …2]
    "Project\Controller\Json\AchievementController" => array:1 [ …1]
    "Project\Controller\Json\Achievement\ExploitableResultController" => array:1 [ …1]
    "Project\Controller\Json\ContractController" => array:3 [ …3]
    "Project\Controller\Json\CostController" => array:5 [ …5]
    "Project\Controller\Json\DescriptionController" => array:1 [ …1]
    "Project\Controller\Json\EffortController" => array:6 [ …6]
    "Project\Controller\Json\FundingController" => array:3 [ …3]
    "Project\Controller\Json\FundingStatusController" => array:2 [ …2]
    "Project\Controller\Json\HelpController" => array:1 [ …1]
    "Project\Controller\Json\IdeaController" => array:1 [ …1]
    "Project\Controller\Json\Idea\ToolController" => array:2 [ …2]
    "Project\Controller\Json\Idea\PosterController" => array:2 [ …2]
    "Project\Controller\Json\InviteController" => array:6 [ …6]
    "Project\Controller\Json\ReportController" => array:1 [ …1]
    "Project\Controller\Json\ResultController" => array:1 [ …1]
    "Project\Controller\Json\WorkpackageController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\TaskController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\DeliverableController" => array:3 [ …3]
    "Project\Controller\Action\TypeController" => array:3 [ …3]
    "Project\Controller\Action\ActionController" => array:10 [ …10]
    "Project\Controller\Event\TypeController" => array:3 [ …3]
    "Project\Controller\SelectionController" => array:4 [ …4]
    "Project\Controller\Event\EventController" => array:5 [ …5]
    "Project\Controller\ChangeRequest\ChangeRequestController" => array:7 [ …7]
    "Project\Controller\ChangeRequest\ProcessController" => array:9 [ …9]
    "Project\Controller\ChangeRequest\UpdateController" => array:14 [ …14]
    "Project\Controller\ChangeRequest\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\Admin\DetailsController" => array:3 [ …3]
    "Project\Controller\Idea\PosterManagerController" => array:5 [ …5]
    "Project\Controller\Idea\PosterController" => array:1 [ …1]
    "Project\Controller\Achievement\AchievementController" => array:6 [ …6]
    "Project\Controller\Achievement\ExploitableResultController" => array:6 [ …6]
    "Project\Controller\Achievement\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\TypeController" => array:2 [ …2]
    "Project\Controller\Achievement\CategoryController" => array:4 [ …4]
    "Project\Controller\Achievement\ExploitableResult\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\ExploitableResult\LinkController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Link\ManagerController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\DocumentController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Document\ManagerController" => array:3 [ …3]
    "Project\Controller\Award\AwardController" => array:3 [ …3]
    "Project\Controller\Award\TypeController" => array:2 [ …2]
    "Project\Controller\Contract\ContractController" => array:6 [ …6]
    "Project\Controller\Contract\DocumentController" => array:1 [ …1]
    "Project\Controller\Contract\VersionController" => array:3 [ …3]
    "Project\Controller\CommunityController" => array:21 [ …21]
    "Project\Controller\Rationale\RationaleController" => array:10 [ …10]
    "Project\Controller\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\DocumentController" => array:5 [ …5]
    "Project\Controller\Document\TypeController" => array:2 [ …2]
    "Project\Controller\EditController" => array:14 [ …14]
    "Project\Controller\FeeManagerController" => array:2 [ …2]
    "Project\Controller\HelpController" => array:3 [ …3]
    "Project\Controller\EventManagerController" => array:4 [ …4]
    "Project\Controller\HelpManagerController" => array:3 [ …3]
    "Project\Controller\ImageController" => array:1 [ …1]
    "Project\Controller\Idea\IdeaController" => array:13 [ …13]
    "Project\Controller\Idea\InviteController" => array:3 [ …3]
    "Project\Controller\Idea\DescriptionController" => array:2 [ …2]
    "Project\Controller\Idea\Description\TypeController" => array:2 [ …2]
    "Project\Controller\Idea\ToolController" => array:1 [ …1]
    "Project\Controller\Idea\ToolManagerController" => array:4 [ …4]
    "Project\Controller\Idea\Tool\Session\ManagerController" => array:5 [ …5]
    "Project\Controller\Idea\Tool\SessionController" => array:2 [ …2]
    "Project\Controller\Idea\PartnerController" => array:3 [ …3]
    "Project\Controller\Idea\DocumentController" => array:2 [ …2]
    "Project\Controller\Idea\ImageController" => array:2 [ …2]
    "Project\Controller\Idea\VideoController" => array:3 [ …3]
    "Project\Controller\Idea\MeetingController" => array:4 [ …4]
    "Project\Controller\Idea\MeetingManagerController" => array:3 [ …3]
    "Project\Controller\Idea\Meeting\InviteController" => array:5 [ …5]
    "Project\Controller\Idea\MessageController" => array:3 [ …3]
    "Project\Controller\Idea\Message\DocumentController" => array:1 [ …1]
    "Project\Controller\Idea\StatusController" => array:3 [ …3]
    "Project\Controller\Idea\Status\DocumentController" => array:1 [ …1]
    "Project\Controller\InviteController" => array:6 [ …6]
    "Project\Controller\PcaController" => array:3 [ …3]
    "Project\Controller\PcaManagerController" => array:5 [ …5]
    "Project\Controller\LogManagerController" => array:5 [ …5]
    "Project\Controller\Project\AdminController" => array:23 [ …23]
    "Project\Controller\Project\CalendarManagerController" => array:3 [ …3]
    "Project\Controller\Project\ProjectController" => array:2 [ …2]
    "Project\Controller\Project\DetailsController" => array:24 [ …24]
    "Project\Controller\Project\ExportController" => array:1 [ …1]
    "Project\Controller\Project\ManagerController" => array:8 [ …8]
    "Project\Controller\Rationale\ManagerController" => array:4 [ …4]
    "Project\Controller\Report\ReportController" => array:6 [ …6]
    "Project\Controller\Report\DetailsController" => array:11 [ …11]
    "Project\Controller\Report\ItemController" => array:3 [ …3]
    "Project\Controller\Report\ManagerController" => array:10 [ …10]
    "Project\Controller\Report\WindowController" => array:3 [ …3]
    "Project\Controller\Report\Window\ProjectController" => array:2 [ …2]
    "Project\Controller\Result\CategoryController" => array:2 [ …2]
    "Project\Controller\Result\ManagerController" => array:6 [ …6]
    "Project\Controller\Result\TypeController" => array:2 [ …2]
    "Project\Controller\RoadmapController" => array:5 [ …5]
    "Project\Controller\Version\VersionController" => array:11 [ …11]
    "Project\Controller\Version\DocumentController" => array:5 [ …5]
    "Project\Controller\Version\Document\ManagerController" => array:6 [ …6]
    "Project\Controller\Version\ManagerController" => array:15 [ …15]
    "Project\Controller\Version\TypeController" => array:3 [ …3]
    "Project\Controller\Workpackage\WorkpackageController" => array:7 [ …7]
    "Project\Controller\Workpackage\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\DocumentManagerController" => array:5 [ …5]
    "Project\Controller\Workpackage\Deliverable\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\Deliverable\DocumentManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\ManagerController" => array:6 [ …6]
    "Project\Controller\Workpackage\Deliverable\TypeController" => array:3 [ …3]
    "Project\Controller\StatisticsController" => array:1 [ …1]
    "Project\Provider\ProjectProvider" => array:6 [ …6]
    "Project\Provider\Version\VersionProvider" => array:3 [ …3]
    "Project\Job\CometChat\CreateIdeaGroup" => array:4 [ …4]
    "Project\Job\CometChat\UpdateMembersOfIdeaGroup" => array:4 [ …4]
    "Project\Controller\Plugin\CreateExport" => array:4 [ …4]
    "Project\Controller\Plugin\SelectionExport" => array:5 [ …5]
    "Project\Controller\Plugin\Merge\CreateMergedDocument" => array:12 [ …12]
    "Project\Controller\Plugin\Merge\CreateSummaryDocument" => array:4 [ …4]
    "Project\Controller\Plugin\Merge\CreateMergedProjectReport" => array:13 [ …13]
    "Project\Controller\Plugin\Merge\CreateMergedChangeRequestDocument" => array:7 [ …7]
    "Project\Controller\Plugin\CreateVersion" => array:7 [ …7]
    "Project\Controller\Plugin\Checklist\ProjectChecklist" => array:8 [ …8]
    "Project\Controller\Plugin\Checklist\ReportChecklist" => array:5 [ …5]
    "Project\Controller\Plugin\Changes\ProjectChanges" => array:5 [ …5]
    "Project\Controller\Plugin\Checklist\ChangeRequestChecklist" => array:7 [ …7]
    "Project\Controller\Plugin\RenderReportWorkpackageDescriptions" => array:2 [ …2]
    "Project\Controller\Plugin\RenderVersionStatistics" => array:7 [ …7]
    "Project\Controller\Plugin\Achievement\Export" => array:2 [ …2]
    "Project\Controller\Plugin\Achievement\Import" => array:2 [ …2]
    "Project\Controller\Plugin\ActionExport" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\IdeasPerCountryDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Invite\Accept" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Accept" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Export" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionPdf" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionSpreadsheet" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Poster\PosterPdf" => array:3 [ …3]
    "Project\InputFilter\RationaleFilter" => array:1 [ …1]
    "Project\Form\ProjectForm" => array:1 [ …1]
    "Project\Service\ProjectService" => array:9 [ …9]
    "Project\Service\ActionService" => array:5 [ …5]
    "Project\Service\VersionService" => array:3 [ …3]
    "Project\Service\WorkpackageService" => array:4 [ …4]
    "Project\Service\IdeaService" => array:12 [ …12]
    "Project\Service\Idea\MeetingService" => array:2 [ …2]
    "Project\Service\Idea\Tool\SessionService" => array:2 [ …2]
    "Project\Service\DescriptionService" => array:3 [ …3]
    "Project\Service\ResultService" => array:4 [ …4]
    "Project\Service\VersionDocumentService" => array:4 [ …4]
    "Project\Service\EventService" => array:2 [ …2]
    "Project\Service\HelpService" => array:2 [ …2]
    "Project\Service\KeywordService" => array:1 [ …1]
    "Project\Service\AchievementService" => array:4 [ …4]
    "Project\Service\Achievement\ExploitableResultService" => array:4 [ …4]
    "Project\Service\ReportService" => array:2 [ …2]
    "Project\Service\DocumentService" => array:1 [ …1]
    "Project\Service\ContractService" => array:2 [ …2]
    "Project\Service\InviteService" => array:6 [ …6]
    "Project\Service\SelectionService" => array:1 [ …1]
    "Project\Service\AwardService" => array:1 [ …1]
    "Project\Service\ChangeRequestService" => array:7 [ …7]
    "Project\Service\Report\WindowService" => array:1 [ …1]
    "Project\Search\Service\AchievementSearchService" => array:1 [ …1]
    "Project\Search\Service\Achievement\ExploitableResultSearchService" => array:1 [ …1]
    "Project\Search\Service\IdeaSearchService" => array:1 [ …1]
    "Project\Search\Service\DescriptionSearchService" => array:1 [ …1]
    "Project\Search\Service\ProjectSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\WorkpackageDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\ResultSearchService" => array:1 [ …1]
    "Project\Search\Service\ActionSearchService" => array:1 [ …1]
    "Project\View\Handler\ProjectHandler" => array:16 [ …16]
    "Project\View\Handler\ResultHandler" => array:8 [ …8]
    "Project\View\Handler\IdeaHandler" => array:11 [ …11]
    "Project\View\Helper\Project\StatusIcon" => array:1 [ …1]
    "Project\View\Helper\Project\ProjectDates" => array:3 [ …3]
    "Project\View\Helper\Description\BuildContent" => array:1 [ …1]
    "Project\View\Helper\Description\BuildNavigation" => array:2 [ …2]
    "Project\View\Helper\Description\BuildTree" => array:2 [ …2]
    "Project\View\Helper\Project\Quickstart" => array:2 [ …2]
    "Project\View\Helper\BuildHelp" => array:3 [ …3]
    "Project\View\Helper\Version\VersionLink" => array:6 [ …6]
    "Project\View\Helper\HelpLink" => array:6 [ …6]
    "Project\View\Helper\Report\ReportHelper" => array:1 [ …1]
    "Project\Form\View\Helper\ProjectFormElement" => array:2 [ …2]
    "Evaluation\Controller\ReportController" => array:4 [ …4]
    "Evaluation\Controller\FeedbackController" => array:4 [ …4]
    "Evaluation\Controller\EvaluationController" => array:10 [ …10]
    "Evaluation\Controller\EvaluationManagerController" => array:4 [ …4]
    "Evaluation\Controller\ReportManagerController" => array:5 [ …5]
    "Evaluation\Controller\Report\CriterionController" => array:4 [ …4]
    "Evaluation\Controller\Report\VersionController" => array:4 [ …4]
    "Evaluation\Controller\Report\WindowController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\CategoryController" => array:2 [ …2]
    "Evaluation\Controller\Report\Criterion\TypeController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\TopicController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\VersionController" => array:3 [ …3]
    "Evaluation\Controller\ReviewerManagerController" => array:5 [ …5]
    "Evaluation\Controller\ReviewScheduleController" => array:5 [ …5]
    "Evaluation\Controller\Reviewer\ContactManagerController" => array:2 [ …2]
    "Evaluation\Controller\JsonController" => array:3 [ …3]
    "Evaluation\Controller\Plugin\CreateEvaluation" => array:5 [ …5]
    "Evaluation\Controller\Plugin\RosterGenerator" => array:3 [ …3]
    "Evaluation\Controller\Plugin\Report\ExcelExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ExcelDownload" => array:2 [ …2]
    "Evaluation\Controller\Plugin\Report\ExcelImport" => array:1 [ …1]
    "Evaluation\Controller\Plugin\Report\PdfExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ConsolidatedPdfExport" => array:10 [ …10]
    "Evaluation\Controller\Plugin\Report\Presentation" => array:2 [ …2]
    "Evaluation\Controller\Plugin\RenderProjectEvaluation" => array:3 [ …3]
    "Evaluation\Service\EvaluationService" => array:1 [ …1]
    "Evaluation\Service\EvaluationReportService" => array:2 [ …2]
    "Evaluation\Service\ReviewerService" => array:1 [ …1]
    "Evaluation\Service\ReviewRosterService" => array:5 [ …5]
    "Evaluation\View\Helper\Report\Progress" => array:2 [ …2]
    "Evaluation\View\Helper\Report\Score" => array:1 [ …1]
    "Press\Controller\ArticleController" => array:5 [ …5]
    "Press\Controller\BureauController" => array:3 [ …3]
    "Press\Controller\PressController" => array:1 [ …1]
    "Press\Service\PressService" => array:2 [ …2]
    "Press\Search\Service\PressSearchService" => array:1 [ …1]
    "Press\View\Handler\PressHandler" => array:7 [ …7]
    "Program\Controller\Plugin\CreateCallFundingOverview" => array:5 [ …5]
    "Program\Controller\Plugin\CreateFundingDownload" => array:3 [ …3]
    "Program\Controller\Plugin\RenderDoa" => array:3 [ …3]
    "Program\Controller\Plugin\RenderNda" => array:3 [ …3]
    "Program\Controller\Plugin\CallSizeSpreadsheet" => array:8 [ …8]
    "Program\Controller\CallController" => array:6 [ …6]
    "Program\Controller\CallCountryManagerController" => array:4 [ …4]
    "Program\Controller\CallManagerController" => array:9 [ …9]
    "Program\Controller\DoaController" => array:4 [ …4]
    "Program\Controller\FunderManagerController" => array:3 [ …3]
    "Program\Controller\NdaController" => array:6 [ …6]
    "Program\Controller\NdaManagerController" => array:8 [ …8]
    "Program\Controller\ProgramManagerController" => array:3 [ …3]
    "Program\Service\ProgramService" => array:5 [ …5]
    "Program\Service\CallService" => array:3 [ …3]
    "Program\View\Handler\ProgramHandler" => array:6 [ …6]
    "Program\View\Helper\CallInformationBox" => array:3 [ …3]
    "Search\Controller\IndexController" => array:1 [ …1]
    "Search\Command\UpdateIndex" => array:1 [ …1]
    "Search\Service\ConsoleService" => array:22 [ …22]
    "Admin\Controller\AccessController" => array:5 [ …5]
    "Admin\Controller\AdminController" => array:9 [ …9]
    "Admin\Controller\QueueController" => array:2 [ …2]
    "Admin\Controller\Api\LogController" => array:1 [ …1]
    "Admin\Controller\UserController" => array:5 [ …5]
    "Admin\Controller\OAuth2Controller" => array:3 [ …3]
    "Admin\Controller\OAuth2\ClientController" => array:3 [ …3]
    "Admin\Controller\OAuth2\ScopeController" => array:2 [ …2]
    "Admin\Controller\StatisticsController" => array:3 [ …3]
    "Admin\Controller\CacheController" => array:1 [ …1]
    "Admin\Controller\FixController" => []
    "Admin\Controller\PermitController" => array:3 [ …3]
    "Admin\InputFilter\AccessFilter" => array:1 [ …1]
    "Admin\Service\AdminService" => array:3 [ …3]
    "Admin\Service\StatisticsService" => array:1 [ …1]
    "Admin\Service\QueueService" => array:1 [ …1]
    "Admin\Service\ApiService" => array:1 [ …1]
    "Admin\Service\OAuth2Service" => array:1 [ …1]
    "Admin\Form\View\Helper\AccessFormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormCheckbox" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterBarElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterColumnElement" => array:2 [ …2]
    "Affiliation\Controller\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\EditController" => array:11 [ …11]
    "Affiliation\Controller\Admin\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\Admin\IndexController" => array:4 [ …4]
    "Affiliation\Controller\Admin\EditController" => array:11 [ …11]
    "Affiliation\Controller\Json\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Json\LoiController" => array:4 [ …4]
    "Affiliation\Controller\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Doa\ManagerController" => array:9 [ …9]
    "Affiliation\Controller\LoiController" => array:5 [ …5]
    "Affiliation\Controller\Loi\ManagerController" => array:7 [ …7]
    "Affiliation\Controller\Questionnaire\CategoryManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireController" => array:4 [ …4]
    "Affiliation\Provider\AffiliationProvider" => array:2 [ …2]
    "Affiliation\Service\AffiliationService" => array:14 [ …14]
    "Affiliation\Service\QuestionnaireService" => array:2 [ …2]
    "Affiliation\Service\DoaService" => array:1 [ …1]
    "Affiliation\Service\LoiService" => array:1 [ …1]
    "Affiliation\Controller\Plugin\RenderPaymentSheet" => array:9 [ …9]
    "Affiliation\Controller\Plugin\RenderLoi" => array:3 [ …3]
    "Affiliation\Controller\Plugin\MergeAffiliation" => array:2 [ …2]
    "Affiliation\View\Helper\PaymentSheet" => array:8 [ …8]
    "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper" => array:1 [ …1]
    "Organisation\Controller\JsonController" => array:3 [ …3]
    "Organisation\Controller\Organisation\NoteController" => array:3 [ …3]
    "Organisation\Controller\ImageController" => array:3 [ …3]
    "Organisation\Controller\BoardController" => array:3 [ …3]
    "Organisation\Controller\Organisation\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Organisation\FinancialController" => array:4 [ …4]
    "Organisation\Controller\Organisation\ListController" => array:2 [ …2]
    "Organisation\Controller\Organisation\ManagerController" => array:7 [ …7]
    "Organisation\Controller\Organisation\TypeController" => array:3 [ …3]
    "Organisation\Controller\AdvisoryBoard\City\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\City\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\AdvisoryBoard\Solution\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\Solution\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\SelectionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ContributionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ManagerController" => array:5 [ …5]
    "Organisation\Controller\Parent\ListController" => array:5 [ …5]
    "Organisation\Controller\Parent\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Parent\OrganisationController" => array:6 [ …6]
    "Organisation\Controller\Parent\TypeController" => array:3 [ …3]
    "Organisation\Controller\Parent\DoaController" => array:6 [ …6]
    "Organisation\Controller\Parent\FinancialController" => array:6 [ …6]
    "Organisation\Controller\UpdateController" => array:4 [ …4]
    "Organisation\Controller\Update\ManagerController" => array:5 [ …5]
    "Organisation\Command\Cleanup" => array:1 [ …1]
    "Organisation\Search\Service\OrganisationSearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => array:1 [ …1]
    "Organisation\View\Handler\OrganisationHandler" => array:9 [ …9]
    "Organisation\View\Handler\AdvisoryBoard\CityHandler" => array:7 [ …7]
    "Organisation\View\Handler\AdvisoryBoard\SolutionHandler" => array:7 [ …7]
    "Organisation\Controller\Plugin\HandleParentAndProjectImport" => array:8 [ …8]
    "Organisation\Controller\Plugin\RenderOverviewExtraVariableContributionSheet" => array:7 [ …7]
    "Organisation\Controller\Plugin\RenderOverviewVariableContributionSheet" => array:8 [ …8]
    "Organisation\Controller\Plugin\Merge\OrganisationMerge" => array:4 [ …4]
    "Organisation\Controller\Plugin\Merge\ParentOrganisationMerge" => array:2 [ …2]
    "Organisation\Controller\Plugin\SelectionExport" => array:2 [ …2]
    "Organisation\Form\OrganisationForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\CityForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\SolutionForm" => array:1 [ …1]
    "Organisation\Form\UpdateForm" => array:1 [ …1]
    "Organisation\Form\FinancialForm" => array:1 [ …1]
    "Organisation\Form\View\Helper\OrganisationFormElement" => array:3 [ …3]
    "Organisation\Form\View\Helper\ParentFormElement" => array:2 [ …2]
    "Organisation\View\Helper\UpdateNotification" => array:2 [ …2]
    "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution" => array:7 [ …7]
    "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution" => array:7 [ …7]
    "Organisation\Service\AdvisoryBoard\CityService" => array:3 [ …3]
    "Organisation\Service\AdvisoryBoard\SolutionService" => array:3 [ …3]
    "Organisation\Service\BoardService" => array:1 [ …1]
    "Organisation\Service\SelectionService" => array:1 [ …1]
    "Organisation\Service\UpdateService" => array:3 [ …3]
    "Publication\Acl\Assertion\Publication" => array:4 [ …4]
    "Publication\Controller\CategoryController" => array:3 [ …3]
    "Publication\Controller\CommunityController" => array:1 [ …1]
    "Publication\Controller\PublicationController" => array:1 [ …1]
    "Publication\Controller\PublicationManagerController" => array:5 [ …5]
    "Publication\Controller\TypeController" => array:4 [ …4]
    "Publication\Search\Service\PublicationSearchService" => array:1 [ …1]
    "Publication\Service\PublicationService" => array:3 [ …3]
    "Invoice\Controller\ConsoleController" => array:1 [ …1]
    "Invoice\Controller\DimensionController" => array:3 [ …3]
    "Invoice\Controller\ExportController" => array:2 [ …2]
    "Invoice\Controller\ForecastController" => array:3 [ …3]
    "Invoice\Controller\InvoiceController" => array:17 [ …17]
    "Invoice\Controller\InvoiceCreateController" => array:15 [ …15]
    "Invoice\Controller\JournalController" => array:1 [ …1]
    "Invoice\Controller\PdfController" => array:1 [ …1]
    "Invoice\Controller\ReminderController" => array:7 [ …7]
    "Invoice\Controller\RowController" => array:4 [ …4]
    "Invoice\Controller\TransactionController" => array:2 [ …2]
    "Invoice\Controller\WordController" => array:1 [ …1]
    "Invoice\Command\DailyUpdate" => array:4 [ …4]
    "Invoice\Command\Sync" => array:1 [ …1]
    "Invoice\Controller\Plugin\CreateCreditInvoice" => array:2 [ …2]
    "Invoice\Controller\Plugin\CreateIncomeForecast" => array:6 [ …6]
    "Invoice\Controller\Plugin\InvoiceExport" => array:3 [ …3]
    "Invoice\Controller\Plugin\InvoiceExportUbl" => array:4 [ …4]
    "Invoice\Controller\Plugin\RenderInvoice" => array:8 [ …8]
    "Invoice\Controller\Plugin\RenderReminder" => array:5 [ …5]
    "Invoice\Controller\Plugin\CreateInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentInvoice" => array:4 [ …4]
    "Invoice\Controller\Plugin\CreateWordInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentExtraInvoice" => array:4 [ …4]
    "Invoice\Service\InvoiceService" => array:9 [ …9]
    "Invoice\Service\TransactionService" => array:3 [ …3]
    "Invoice\Search\Service\InvoiceSearchService" => array:1 [ …1]
    "Invoice\View\Helper\DailyUpdateHandler" => array:2 [ …2]
    "Deeplink\Controller\DeeplinkController" => array:5 [ …5]
    "Deeplink\Controller\TargetController" => array:4 [ …4]
    "Deeplink\InputFilter\TargetFilter" => array:2 [ …2]
    "Deeplink\Service\DeeplinkService" => array:2 [ …2]
    "Deeplink\View\Helper\CanAssemble" => array:1 [ …1]
    "Event\Controller\BadgeImageManagerController" => array:9 [ …9]
    "Event\Controller\BadgeManagerController" => array:13 [ …13]
    "Event\Controller\BoothController" => array:10 [ …10]
    "Event\Controller\BoothManagerController" => array:9 [ …9]
    "Event\Controller\BoothSpecManagerController" => array:4 [ …4]
    "Event\Controller\DeskCostsController" => array:2 [ …2]
    "Event\Controller\ExhibitionCostController" => array:3 [ …3]
    "Event\Controller\ExhibitionSpecManagerController" => array:3 [ …3]
    "Event\Controller\ExhibitionManagerController" => array:5 [ …5]
    "Event\Controller\ExportController" => array:1 [ …1]
    "Event\Controller\JsonController" => array:4 [ …4]
    "Event\Controller\Meeting\AdminController" => array:4 [ …4]
    "Event\Controller\Meeting\MeetingController" => array:9 [ …9]
    "Event\Controller\Meeting\CostController" => array:2 [ …2]
    "Event\Controller\Meeting\QuotaController" => array:4 [ …4]
    "Event\Controller\Meeting\CouponController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionCostController" => array:2 [ …2]
    "Event\Controller\Meeting\FloorplanController" => array:5 [ …5]
    "Event\Controller\Meeting\ManagerController" => array:14 [ …14]
    "Event\Controller\RegistrationController" => array:9 [ …9]
    "Event\Controller\PaymentController" => array:3 [ …3]
    "Event\Controller\RegistrationManagerController" => array:7 [ …7]
    "Event\Controller\TicketManagerController" => array:11 [ …11]
    "Event\Job\CometChat\CreateUser" => array:3 [ …3]
    "Event\Job\CometChat\CreateAuthToken" => array:3 [ …3]
    "Event\Job\CometChat\DeleteUser" => array:3 [ …3]
    "Event\Command\CancelPaymentPending" => array:1 [ …1]
    "Event\Command\UpdateRegistrations" => array:1 [ …1]
    "Event\Controller\Plugin\BoothExport" => array:3 [ …3]
    "Event\Controller\Plugin\RegistrationExport" => array:1 [ …1]
    "Event\Controller\Plugin\RenderReceipt" => array:4 [ …4]
    "Event\Controller\Plugin\MeetingFacebook" => array:4 [ …4]
    "Event\Controller\Plugin\BadgePdf" => array:5 [ …5]
    "Event\Controller\Plugin\TicketPdf" => array:4 [ …4]
    "Event\View\Handler\MeetingHandler" => array:8 [ …8]
    "Event\View\Helper\RegistrationLink" => array:6 [ …6]
    "Event\Search\Service\RegistrationSearchService" => array:1 [ …1]
    "Event\Service\BadgeService" => array:1 [ …1]
    "Event\Service\MeetingService" => array:4 [ …4]
    "Event\Service\ExhibitionService" => array:1 [ …1]
    "Event\Service\BoothService" => array:3 [ …3]
    "Event\Service\RegistrationService" => array:16 [ …16]
    "Event\Service\ExhibitionFloorplanService" => array:1 [ …1]
    "Event\Service\ExhibitionSpecService" => array:1 [ …1]
    "Calendar\Controller\CalendarController" => array:2 [ …2]
    "Calendar\Controller\TypeController" => array:2 [ …2]
    "Calendar\Controller\CommunityController" => array:11 [ …11]
    "Calendar\Controller\DocumentController" => array:4 [ …4]
    "Calendar\Controller\JsonController" => array:1 [ …1]
    "Calendar\Controller\ManagerController" => array:10 [ …10]
    "Calendar\Controller\Plugin\RenderCalendarContactList" => array:3 [ …3]
    "Calendar\Controller\Plugin\RenderReviewCalendar" => array:2 [ …2]
    "Calendar\Service\CalendarService" => array:7 [ …7]
    "Calendar\Search\Service\CalendarSearchService" => array:1 [ …1]
    "Calendar\View\Handler\CalendarHandler" => array:7 [ …7]
    "Mailing\Command\FlushQueue" => array:1 [ …1]
    "Mailing\Command\SendQueue" => array:1 [ …1]
    "Mailing\Controller\AttachmentController" => array:2 [ …2]
    "Mailing\Controller\ConsoleController" => array:1 [ …1]
    "Mailing\Controller\MailingContactController" => array:1 [ …1]
    "Mailing\Controller\MailingManagerController" => array:6 [ …6]
    "Mailing\Controller\JsonController" => array:3 [ …3]
    "Mailing\Controller\MailingSubscriptionController" => array:6 [ …6]
    "Mailing\Controller\SenderManagerController" => array:3 [ …3]
    "Mailing\Controller\TemplateManagerController" => array:3 [ …3]
    "Mailing\InputFilter\MailingFilter" => array:1 [ …1]
    "Mailing\InputFilter\SenderFilter" => array:1 [ …1]
    "Mailing\InputFilter\TemplateFilter" => array:1 [ …1]
    "Mailing\Service\MailingService" => array:4 [ …4]
    "Accounting\Controller\TwinfieldController" => array:2 [ …2]
    "Accounting\Adapter\TwinfieldAdapter" => array:3 [ …3]
  ]
  "lmc_cors" => array:3 [
    "allowed_origins" => array:1 [ …1]
    "allowed_methods" => array:5 [ …5]
    "allowed_headers" => array:3 [ …3]
  ]
  "console" => array:1 [
    "router" => array:1 [ …1]
  ]
  "zfctwig" => array:9 [
    "environment_loader" => "ZfcTwigLoaderChain"
    "environment_class" => "Twig\Environment"
    "environment_options" => array:2 [ …2]
    "loader_chain" => array:3 [ …3]
    "extensions" => array:14 [ …14]
    "suffix" => "twig"
    "enable_fallback_functions" => true
    "disable_zf_model" => false
    "helper_manager" => array:1 [ …1]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [ …6]
    "toolbar" => array:5 [ …5]
    "events" => array:3 [ …3]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:7 [ …7]
    "factories" => array:7 [ …7]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [ …1]
  ]
  "translator" => array:3 [
    "locale" => "en_GB"
    "cache" => true
    "translation_file_patterns" => array:1 [ …1]
  ]
  "web" => array:5 [
    "title" => "ITEA 4"
    "description" => "ITEA is the Eureka R&D&I Cluster programme for software innovation, enabling a large international community to collaborate in funded projects that turn innovative ideas into new businesses, jobs, economic growth and benefits for society."
    "keywords" => "Software-intensive Systems & Services, EUREKA Cluster, R&D, R&D projects, Innovation, Business Impact, Seizing the high ground, Fast Exploitation, Happiness"
    "author" => "Johan van der Heide, johan.van.der.heide[at]itea4.org"
    "site_name" => "itea4.org"
  ]
  "authenticate" => array:1 [
    "useAdditionalEmailAddresses" => true
  ]
  "session_config" => array:3 [
    "cache_expire" => 86400
    "cookie_lifetime" => 86400
    "name" => "itea"
  ]
  "navigation" => array:6 [
    "default" => []
    "project-community" => []
    "community" => array:6 [ …6]
    "admin" => array:14 [ …14]
    "community2" => array:1 [ …1]
    "call" => array:6 [ …6]
  ]
  "content_option" => array:3 [
    "vimeoClientId" => "08fdab5ca150505195e18a91774f67a6bae59cd3"
    "vimeoClientSecret" => "5Dc8mhmhiByGpBp7XFoY7+6rTi5NXGu+OWuU4E97JELWz3oNryFAP0GsbC/h9tvY4KA3dTORoQ31dIk5AGx1HRwjR5t2uXTpZEHMSkWdnjqKi3GFs7acWyzg6mIGEfdV"
    "vimeoAccessToken" => "947086738c8843c59ea7755d410c2288"
  ]
  "general_option" => array:5 [
    "serverUrl" => "https://dev1.itea4.org"
    "thumborServer" => "https://image.itea3.org"
    "thumborSecret" => "mKiWlumnpbX1YWpW6lbm"
    "assets" => "/var/www/dev1/config/itea/../../styles/itea/img"
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "cluster_options" => array:2 [
    "reporting_portal_api_url" => "https://api.eurekaclusters.eu"
    "bearer_token" => "abcd"
  ]
  "slm_queue" => array:6 [
    "job_manager" => array:1 [ …1]
    "queues" => array:1 [ …1]
    "worker_strategies" => array:2 [ …2]
    "strategy_manager" => array:2 [ …2]
    "queue_manager" => array:1 [ …1]
    "worker_manager" => []
  ]
  "project_option" => array:9 [
    "rationale_require_contact_with_funder" => false
    "evaluation_project_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "evaluation_report_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "evaluation_presentation_templates" => array:2 [ …2]
    "evaluation_report_author" => "Itea Office"
    "project_summary_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/project-summary.docx"
    "change_request_document_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/cr-document.docx"
    "header_logo" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/footer.png"
  ]
  "evaluation_options" => array:4 [
    "projectTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "reportTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "presentationTemplates" => array:2 [ …2]
    "reportAuthor" => "ITEA Office"
  ]
  "program_option" => array:6 [
    "nda_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "doa_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "blank_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "has_nda" => true
    "header_logo" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/footer.png"
  ]
  "google" => array:1 [
    "cx" => "009339216969913709813:g_lfsuqxjz0"
  ]
  "solr" => array:2 [
    "host" => "app2"
    "connection" => array:23 [ …23]
  ]
  "admin_option" => array:1 [
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "affiliation_option" => array:3 [
    "doa_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/doa-template.pdf"
    "loi_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/nda-template.pdf"
    "payment_sheet_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "organisation_option" => array:2 [
    "overview_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
    "overview_extra_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
  ]
  "invoice_option" => array:11 [
    "mollie_api_key" => "live_lsaXAz3GAweHE1zzTr15WPt5FEZFeB"
    "payment_days" => 30
    "complaint_days" => 14
    "contract_data_start_year" => 2018
    "invoice_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/pdf/invoice-template.pdf"
    "variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/variable-fee-template.docx"
    "extra_variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/extra-variable-fee-template.docx"
    "invoice_mask" => "YYYY####"
    "local_country" => "NLD"
    "bcc_email_address" => "finance@itea4.org"
    "from_email_address" => "finance@itea4.org"
  ]
  "event_option" => array:1 [
    "receipt_template" => "/var/www/dev1/module/event/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "calendar_option" => array:2 [
    "calendar_contact_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "review_calendar_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/review-calendar-template.pdf"
  ]
  "google_analytics" => array:7 [
    "enable" => true
    "id" => ""
    "domain_name" => ""
    "allow_linker" => false
    "enable_display_advertising" => false
    "anonymize_ip" => false
    "script" => "google-analytics-ga"
  ]
  "accounting_options" => array:5 [
    "clientId" => ""
    "clientSecret" => ""
    "refreshToken" => ""
    "redirectURL" => ""
    "office" => ""
  ]
  "listeners" => array:1 [
    0 => "ErrorHeroModule\Listener\Mvc"
  ]
  "email" => array:3 [
    "general" => array:2 [ …2]
    "smtp" => array:5 [ …5]
    "mailjet" => array:2 [ …2]
  ]
  "log" => array:1 [
    "ErrorHeroModuleLogger" => array:1 [ …1]
  ]
  "error-hero-module" => array:5 [
    "enable" => true
    "enable-error-preview-page" => true
    "display-settings" => array:6 [ …6]
    "logging-settings" => array:1 [ …1]
    "email-notification-settings" => array:5 [ …5]
  ]
  "jield_authorize" => array:6 [
    "default_role" => "public"
    "authenticated_role" => "user"
    "access_service" => "Admin\Service\AdminService"
    "permit_service" => "Contact\Service\ContactService"
    "cache_enabled" => true
    "role_entity_class" => "Admin\Entity\Access"
  ]
  "circlical" => array:1 [
    "recaptcha" => array:3 [ …3]
  ]
  "accounting" => array:2 [
    "adapter" => "Accounting\Adapter\Twinfield"
    "options" => array:7 [ …7]
  ]
  "cache" => array:1 [
    "adapter" => array:2 [ …2]
  ]
  "cometchat" => array:5 [
    "app_id" => "190005357f8fde86"
    "region" => "eu"
    "version" => 2
    "auth_key" => "f333a70ecae8f9362a869d8a5753dea3156109c8"
    "api_key" => "344ac4fb44725064a40306c597afac4ba3430f81"
  ]
  "zfr_cors" => array:1 [
    "allowed_origins" => array:3 [ …3]
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
^ array:3 [
  "modules" => array:63 [
    0 => "Laminas\Cache"
    1 => "Laminas\Router"
    2 => "Laminas\Form"
    3 => "Laminas\Navigation"
    4 => "Laminas\Filter"
    5 => "Laminas\Hydrator"
    6 => "Laminas\InputFilter"
    7 => "Laminas\Paginator"
    8 => "Laminas\Router"
    9 => "Laminas\Log"
    10 => "Laminas\Validator"
    11 => "Laminas\Mvc\Plugin\FlashMessenger"
    12 => "Laminas\Mvc\Plugin\Identity"
    13 => "Laminas\ApiTools"
    14 => "Laminas\ApiTools\Documentation"
    15 => "Laminas\ApiTools\Documentation\Swagger"
    16 => "Laminas\ApiTools\ApiProblem"
    17 => "Laminas\ApiTools\Configuration"
    18 => "Laminas\ApiTools\OAuth2"
    19 => "Laminas\ApiTools\MvcAuth"
    20 => "Laminas\ApiTools\Hal"
    21 => "Laminas\ApiTools\ContentNegotiation"
    22 => "Laminas\ApiTools\ContentValidation"
    23 => "Laminas\ApiTools\Rest"
    24 => "Laminas\ApiTools\Rpc"
    25 => "Laminas\ApiTools\Versioning"
    26 => "Api"
    27 => "LmcCors"
    28 => "AssetManager"
    29 => "ZfcTwig"
    30 => "BjyAuthorize"
    31 => "Jield\Authorize"
    32 => "DoctrineModule"
    33 => "DoctrineORMModule"
    34 => "Application"
    35 => "Content"
    36 => "General"
    37 => "Cluster"
    38 => "News"
    39 => "Contact"
    40 => "Quality"
    41 => "Project"
    42 => "Evaluation"
    43 => "Press"
    44 => "Program"
    45 => "Search"
    46 => "Admin"
    47 => "LaminasBootstrap5"
    48 => "Affiliation"
    49 => "Organisation"
    50 => "Publication"
    51 => "Invoice"
    52 => "Deeplink"
    53 => "Event"
    54 => "Calendar"
    55 => "Mailing"
    56 => "LaminasGoogleAnalytics"
    57 => "Accounting"
    58 => "ErrorHeroModule"
    59 => "CirclicalRecaptcha"
    60 => "SlmQueue"
    61 => "SlmQueueDoctrine"
    62 => "Laminas\DeveloperTools"
  ]
  "module_listener_options" => array:7 [
    "config_glob_paths" => array:2 [
      0 => "config/autoload/{,*.}{global,local}.php"
      1 => "config/itea/{,*.}{global,local}.php"
    ]
    "config_cache_enabled" => false
    "cache_dir" => "/var/www/dev1/config/../data/cache"
    "config_cache_key" => "itea"
    "module_map_cache_enabled" => true
    "module_map_cache_key" => "50b41c6263a4a7e8e9298092a44a713d"
    "module_paths" => array:2 [
      0 => "./module"
      1 => "./vendor"
    ]
  ]
  "service_manager" => array:2 [
    "use_defaults" => true
    "factories" => []
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
BjyAuthorize Current Identity Roles public
BjyAuthorize
Identity Roles - 1 role

public
Doctrine ORM (Queries) 31 queries in 24.30 ms
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.session_id AS session_id_1, t0.session_key AS session_key_2, t0.session_name AS session_name_3, t0.ip AS ip_4, t0.date_start AS date_start_5, t0.date_end AS date_end_6, t0.modified AS modified_7, t0.lifetime AS lifetime_8, t0.hits AS hits_9, t0.data AS data_10, t0.contact_id AS contact_id_11 FROM session t0 WHERE t0.session_key = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'iiq27hrkdjmnt0c2ktjc7007v4' (length=26)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0018060207366943
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00094723701477051
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00076103210449219
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0013799667358398
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'organisation' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00085711479187012
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 122
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00080990791320801
SQL SELECT t0.content_id AS content_id_1, t0.sequence AS sequence_2, t0.handler_id AS handler_id_3, t0.segment_id AS segment_id_4, t0.node_id AS node_id_5 FROM content t0 WHERE t0.node_id = ? ORDER BY t0.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 122
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00084304809570312
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061988830566406
SQL SELECT t0.article_id AS article_id_1, t0.article AS article_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.sequence AS sequence_5, t0.body AS body_6, t0.css AS css_7, t0.hide_from_navigation AS hide_from_navigation_8, t0.article_in_title AS article_in_title_9, t0.topic_id AS topic_id_10 FROM article t0 WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'organisation' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00095701217651367
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 161
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067782402038574
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN article_access ON t0.access_id = article_access.access_id WHERE article_access.article_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 135
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0011410713195801
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00059604644775391
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'organisation' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00060486793518066
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 97
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.001054048538208
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060701370239258
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00055122375488281
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00051093101501465
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00059199333190918
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054597854614258
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053501129150391
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image old-green dots' (length=54)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00063204765319824
SQL SELECT t0.segment_id AS segment_id_1, t0.segment AS segment_2 FROM content_segment t0 WHERE t0.segment_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005640983581543
SQL SELECT t0.param_id AS param_id_1, t0.param AS param_2 FROM content_handler_param t0 WHERE t0.param_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 32
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058603286743164
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00092816352844238
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'organisation' (length=12)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00070500373840332
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.topic_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 48
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054502487182617
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1477
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082612037658691
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1504
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010340213775635
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00073695182800293
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00072288513183594
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1587
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062108039855957
Doctrine ORM (Mappings) 389 mappings
DoctrineORMModule Mappings for doctrine.mapping_collector.orm_default
Admin\Entity\Access
Admin\Entity\Api\Log
Admin\Entity\Pageview
Admin\Entity\Permit\Contact
Admin\Entity\Permit\Entity
Admin\Entity\Permit\Role
Admin\Entity\Permit\Setter
Admin\Entity\Queue
Admin\Entity\Session
Affiliation\Entity\Affiliation
Affiliation\Entity\ContractVersion
Affiliation\Entity\Description
Affiliation\Entity\Doa
Affiliation\Entity\DoaObject
Affiliation\Entity\Doa\Reminder
Affiliation\Entity\Financial
Affiliation\Entity\Invoice
Affiliation\Entity\Log
Affiliation\Entity\Loi
Affiliation\Entity\LoiObject
Affiliation\Entity\Questionnaire\Answer
Affiliation\Entity\Questionnaire\Category
Affiliation\Entity\Questionnaire\Phase
Affiliation\Entity\Questionnaire\Question
Affiliation\Entity\Questionnaire\Questionnaire
Affiliation\Entity\Questionnaire\QuestionnaireQuestion
Affiliation\Entity\Version
Api\Entity\OAuth\AccessToken
Api\Entity\OAuth\AuthorizationCode
Api\Entity\OAuth\Client
Api\Entity\OAuth\Jwt
Api\Entity\OAuth\PublicKey
Api\Entity\OAuth\RefreshToken
Api\Entity\OAuth\Scope
Calendar\Entity\Calendar
Calendar\Entity\Contact
Calendar\Entity\ContactRole
Calendar\Entity\ContactStatus
Calendar\Entity\Document
Calendar\Entity\DocumentObject
Calendar\Entity\Type
Cluster\Entity\Cluster
Cluster\Entity\Cluster\Logo
Cluster\Entity\Statistics\Partner
Contact\Entity\Address
Contact\Entity\AddressType
Contact\Entity\AddressTypeSort
Contact\Entity\Contact
Contact\Entity\ContactOrganisation
Contact\Entity\Dnd
Contact\Entity\DndObject
Contact\Entity\Email
Contact\Entity\Facebook
Contact\Entity\Log
Contact\Entity\Note
Contact\Entity\Office\Contact
Contact\Entity\Office\Leave
Contact\Entity\Office\LeaveType
Contact\Entity\OptIn
Contact\Entity\Phone
Contact\Entity\PhoneType
Contact\Entity\Photo
Contact\Entity\Profile
Contact\Entity\Selection
Contact\Entity\SelectionContact
Contact\Entity\SelectionSql
Contact\Entity\Selection\Type
Content\Entity\Article
Content\Entity\Article\Version
Content\Entity\Content
Content\Entity\ContentParam
Content\Entity\Handler
Content\Entity\Image
Content\Entity\ImageObject
Content\Entity\Main
Content\Entity\Node
Content\Entity\Param
Content\Entity\Route
Content\Entity\Segment
Content\Entity\Template
Content\Entity\Topic
Content\Entity\Tree
Content\Entity\Video
Deeplink\Entity\Contact
Deeplink\Entity\Custom
Deeplink\Entity\Deeplink
Deeplink\Entity\Target
Evaluation\Entity\Evaluation
Evaluation\Entity\Feedback
Evaluation\Entity\Report
Evaluation\Entity\Report\Criterion
Evaluation\Entity\Report\Criterion\Category
Evaluation\Entity\Report\Criterion\Topic
Evaluation\Entity\Report\Criterion\Type
Evaluation\Entity\Report\Criterion\Version
Evaluation\Entity\Report\Criterion\VersionTopic
Evaluation\Entity\Report\ProjectReport
Evaluation\Entity\Report\ProjectVersion
Evaluation\Entity\Report\Result
Evaluation\Entity\Report\Type
Evaluation\Entity\Report\Version
Evaluation\Entity\Report\Window
Evaluation\Entity\Reviewer
Evaluation\Entity\Reviewer\Contact
Evaluation\Entity\Reviewer\Type
Evaluation\Entity\Type
Event\Entity\Badge\Attachment
Event\Entity\Badge\AttachmentObject
Event\Entity\Badge\Badge
Event\Entity\Badge\Contact
Event\Entity\Booth\Booth
Event\Entity\Booth\Challenge
Event\Entity\Booth\Contact
Event\Entity\Booth\Financial
Event\Entity\Booth\FinancialInvoice
Event\Entity\Booth\Spec
Event\Entity\Exhibition\Cost
Event\Entity\Exhibition\Exhibition
Event\Entity\Exhibition\Floorplan
Event\Entity\Exhibition\FloorplanItem
Event\Entity\Exhibition\Spec
Event\Entity\Exhibition\SpecForm
Event\Entity\Exhibition\SpecGroup
Event\Entity\Exhibition\SpecType
Event\Entity\Exhibition\Tour
Event\Entity\Exhibition\TourBooth
Event\Entity\Exhibition\Vote
Event\Entity\Exhibition\Voter
Event\Entity\Meeting\Badge
Event\Entity\Meeting\Cost
Event\Entity\Meeting\Coupon
Event\Entity\Meeting\Floorplan
Event\Entity\Meeting\Mailing
Event\Entity\Meeting\Meeting
Event\Entity\Meeting\Option
Event\Entity\Meeting\OptionCost
Event\Entity\Meeting\Quota
Event\Entity\Meeting\Ticket
Event\Entity\Meeting\TicketObject
Event\Entity\Registration
Event\Entity\Registration\Desk
Event\Entity\Registration\Desk\Costs
Event\Entity\Registration\Desk\Costs\Option
Event\Entity\Registration\Financial
Event\Entity\Registration\Invoice
Event\Entity\Registration\Option
General\Entity\Challenge
General\Entity\Challenge\Icon
General\Entity\Challenge\Idea\Poster\Icon
General\Entity\Challenge\Idea\Poster\Image
General\Entity\Challenge\Image
General\Entity\Challenge\Pdf
General\Entity\Challenge\Type
General\Entity\ContentType
General\Entity\Country
General\Entity\Country\Video
General\Entity\Currency
General\Entity\EmailMessage
General\Entity\EmailMessageEvent
General\Entity\Eu
General\Entity\Eureka
General\Entity\ExchangeRate
General\Entity\Flag
General\Entity\Gender
General\Entity\Itac
General\Entity\Language
General\Entity\Log
General\Entity\Password
General\Entity\Title
General\Entity\Vat
General\Entity\VatType
General\Entity\WebInfo
Invoice\Entity\Credit
Invoice\Entity\Invoice
Invoice\Entity\Journal
Invoice\Entity\Journal\Entry
Invoice\Entity\Log
Invoice\Entity\Log\Type
Invoice\Entity\Message
Invoice\Entity\Method
Invoice\Entity\Payment
Invoice\Entity\Pdf
Invoice\Entity\Reminder
Invoice\Entity\Reminder\Pdf
Invoice\Entity\Reminder\Type
Invoice\Entity\Row
Invoice\Entity\Sync
Invoice\Entity\Transaction
Invoice\Entity\Vat\Dimension
Invoice\Entity\Word
Mailing\Entity\Attachment
Mailing\Entity\Contact
Mailing\Entity\Deeplink
Mailing\Entity\Mailing
Mailing\Entity\Mailing\Version
Mailing\Entity\Queue
Mailing\Entity\Sender
Mailing\Entity\Template
Mailing\Entity\Type
News\Entity\Blog
News\Entity\Blog\Category
News\Entity\Blog\Message
News\Entity\Blog\Tag
News\Entity\Magazine
News\Entity\Magazine\Article
News\Entity\Magazine\Article\Download
News\Entity\Magazine\Article\Pdf
News\Entity\Magazine\Download
News\Entity\Magazine\Pdf
News\Entity\News
News\Entity\News\Category
Organisation\Entity\AdvisoryBoard\City
Organisation\Entity\AdvisoryBoard\City\Image
Organisation\Entity\AdvisoryBoard\Solution
Organisation\Entity\AdvisoryBoard\Solution\Image
Organisation\Entity\Board
Organisation\Entity\Booth
Organisation\Entity\Description
Organisation\Entity\Financial
Organisation\Entity\Log
Organisation\Entity\Logo
Organisation\Entity\Name
Organisation\Entity\Note
Organisation\Entity\Organisation
Organisation\Entity\ParentEntity
Organisation\Entity\Parent\Doa
Organisation\Entity\Parent\DoaObject
Organisation\Entity\Parent\Financial
Organisation\Entity\Parent\Invoice
Organisation\Entity\Parent\InvoiceExtra
Organisation\Entity\Parent\Organisation
Organisation\Entity\Parent\Type
Organisation\Entity\Selection
Organisation\Entity\Type
Organisation\Entity\Update
Organisation\Entity\UpdateLogo
Organisation\Entity\Web
Press\Entity\Article
Press\Entity\ArticleObject
Press\Entity\Bureau
Program\Entity\Call\Call
Program\Entity\Call\Country
Program\Entity\Doa
Program\Entity\DoaObject
Program\Entity\Funder
Program\Entity\Nda
Program\Entity\NdaObject
Program\Entity\Program
Project\Entity\Achievement
Project\Entity\Achievement\Category
Project\Entity\Achievement\Document
Project\Entity\Achievement\DocumentObject
Project\Entity\Achievement\ExploitableResult
Project\Entity\Achievement\Link
Project\Entity\Achievement\Type
Project\Entity\Action
Project\Entity\Action\Comment
Project\Entity\Action\Type
Project\Entity\Award
Project\Entity\Award\Type
Project\Entity\Booth
Project\Entity\Calendar\Calendar
Project\Entity\Calendar\Reviewer
Project\Entity\ChangeRequest\CostChange
Project\Entity\ChangeRequest\Country
Project\Entity\ChangeRequest\Process
Project\Entity\Changelog
Project\Entity\Contract
Project\Entity\Contract\Cost
Project\Entity\Contract\CostVersion
Project\Entity\Contract\Document
Project\Entity\Contract\DocumentObject
Project\Entity\Contract\Version
Project\Entity\Contract\VersionDocument
Project\Entity\Contract\VersionDocumentObject
Project\Entity\Cost\Cost
Project\Entity\Cost\Version
Project\Entity\Description\Description
Project\Entity\Description\Tree
Project\Entity\Document\Document
Project\Entity\Document\DocumentObject
Project\Entity\Document\Type
Project\Entity\Effort\Effort
Project\Entity\Effort\Spent
Project\Entity\Effort\Version
Project\Entity\Event
Project\Entity\Event\Type
Project\Entity\Fee
Project\Entity\Funding\Funded
Project\Entity\Funding\Funding
Project\Entity\Funding\Source
Project\Entity\Funding\Status
Project\Entity\Funding\Version
Project\Entity\Help
Project\Entity\HelpFaq
Project\Entity\HelpTree
Project\Entity\Idea\Challenge
Project\Entity\Idea\Description
Project\Entity\Idea\Description\Type
Project\Entity\Idea\Document
Project\Entity\Idea\DocumentObject
Project\Entity\Idea\Idea
Project\Entity\Idea\Image
Project\Entity\Idea\ImageObject
Project\Entity\Idea\Invite
Project\Entity\Idea\Meeting
Project\Entity\Idea\Meeting\Invite
Project\Entity\Idea\Meeting\Participant
Project\Entity\Idea\Message
Project\Entity\Idea\Message\Document
Project\Entity\Idea\Message\DocumentObject
Project\Entity\Idea\Partner
Project\Entity\Idea\Poster\Attachment
Project\Entity\Idea\Poster\AttachmentObject
Project\Entity\Idea\Poster\Pdf
Project\Entity\Idea\Poster\Poster
Project\Entity\Idea\Session
Project\Entity\Idea\Status
Project\Entity\Idea\Status\Document
Project\Entity\Idea\Status\DocumentObject
Project\Entity\Idea\Tool
Project\Entity\Idea\Tool\Session
Project\Entity\Idea\Tool\Session\Participant
Project\Entity\Idea\Video
Project\Entity\Image
Project\Entity\Invite
Project\Entity\Keyword
Project\Entity\Log
Project\Entity\Logo
Project\Entity\Pca
Project\Entity\PcaObject
Project\Entity\Poster\Log
Project\Entity\Poster\Poster
Project\Entity\Poster\PosterObject
Project\Entity\Poster\Type
Project\Entity\Project
Project\Entity\Project\Challenge
Project\Entity\Project\Cluster
Project\Entity\Rationale
Project\Entity\Report\EffortSpent
Project\Entity\Report\Item
Project\Entity\Report\ItemObject
Project\Entity\Report\Report
Project\Entity\Report\Reviewer
Project\Entity\Report\Window\Project
Project\Entity\Report\Window\Window
Project\Entity\Report\WorkpackageDescription
Project\Entity\Result\Result
Project\Entity\Result\ResultObject
Project\Entity\Result\Type
Project\Entity\Result\TypeCategory
Project\Entity\Selection
Project\Entity\Version\Contact
Project\Entity\Version\Document
Project\Entity\Version\DocumentObject
Project\Entity\Version\Reviewer
Project\Entity\Version\Type
Project\Entity\Version\Version
Project\Entity\Web
Project\Entity\Workpackage\Contact
Project\Entity\Workpackage\Deliverable
Project\Entity\Workpackage\Deliverable\Document
Project\Entity\Workpackage\Deliverable\DocumentObject
Project\Entity\Workpackage\Deliverable\Type
Project\Entity\Workpackage\Description
Project\Entity\Workpackage\Document
Project\Entity\Workpackage\DocumentObject
Project\Entity\Workpackage\Task
Project\Entity\Workpackage\Workpackage
Publication\Entity\Category
Publication\Entity\Download
Publication\Entity\Publication
Publication\Entity\PublicationObject
Publication\Entity\Type
Quality\Entity\Action
Quality\Entity\Action\Group
Quality\Entity\Action\Result
Quality\Entity\Action\Source
Quality\Entity\Kpi
Quality\Entity\Kpi\Group
Quality\Entity\Kpi\Result
Quality\Entity\Kpi\Target
Quality\Entity\Phase
Quality\Entity\Phase\Type
Quality\Entity\Process
Quality\Entity\Process\Type
Quality\Entity\Status
Quality\Entity\Target
Quality\Entity\Year