ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 page header grey dots

Scope and research areas

ITEA stimulates industry-driven, innovative and pre-competitive R↦D&I projects that will contribute to the digital transformation, improve the position of software innovation of the ITEA Community and the competitiveness of Europe’s software-intensive industry and service sectors and lead to sustainable societal gains.

ITEA projects have shown strong impact in many industries that are crucial for an economic and competitive position. Besides economic impact via employment growth, revenue growth and new investments, ITEA projects have delivered societal solutions and impact for the following key challenges:

These areas are closely related and contribute to the two main challenges, Sustainability/Green Economy and Digital Transition, that Europe has defined for the coming decade. The Digital Transition will contribute to many aspects of sustainability in society: not only renewable energy and power distribution, but also sustainable means of mobility, durable future concepts for health and more.

ITEA Living roadmap

To better support the initiation and evaluation of new ITEA projects and to support the management of ongoing projects, an ITEA Living roadmap has been established including a State-of-the-Art database with public deliverables from ITEA projects. The Living Roadmap has also been extended with information about projects, societal and economic challenges and people as well as the links between them.

On this page you can find the set of challenges as described in the Living Roadmap.

The full version of the Living Roadmap is accessible through the ITEA Community website . Login with your personal credentials and having signed and uploaded the relevant Non-disclosure Agreement (NDA) is needed.

 

Challenges

Smart cities

There is an inevitability that we must face – urbanisation is an unstoppable demographic trend and cities will not get any smaller. With the number of megacities and the people living in them increasing exponentially, the question that arises is how can these cities be smarter ...

Smart communities

Each of us belongs to different communities: at work, leisure, politics, health ... but the fact is that daily life is reducing physical contacts. By contrast, the numbers of digitally connected people are increasing exponentially. The challenge for the smart community is to find a way ...

Smart health

Smart sports, smart foods, smart hospitals ... there is a seemingly unending trend evident today as health and a healthy lifestyle have become paramount to keeping the healthcare system affordable and manageable. 'Smart' has become imperative in dealing with an ever-growing ...

Smart mobility

The more physically connected the world becomes, with 64 million km of roads, 4 million km of railways, 2 million km of pipelines, 1 million km of internet cables, and growing, the smaller it becomes and the more vital the need for smart mobility solutions. Take the mobility market ...

Smart industry

After the steam engine, the assembly line and the success of digital technology, we are witnessing the 4th industrial revolution: the merging of real and virtual worlds. So Smart Industry is naturally one of our main challenges in ITEA. How do we cope with consumer demand ...

Smart energy

Several important trends indicate that the energy sector is a fast-moving industry undergoing transformation. The first driver is the reduction of greenhouse gas emissions linked to the production of energy in the fight against global warming. This is leading to the development...

Smart engineering

Engineering – smart engineering – is indispensable to the constantly evolving systems, products and applications we build. The lifecycle of engineering systems and software is expanding with more and more stakeholders, more roles in development, deployment, manufacturing and operations ...

Safety and Security

Digital literacy encounters the challenge of moving from searching, finding and understanding digital information to managing digital footprints, being aware of copyright issues and behaving ethically in crediting ownership, cognisant of the lasting imprint of information online and managing ...

Laminas
Documentation Modules Gallery PHP Version 8.0.14 Extensions intl ModulesLaminas\CacheLaminas\RouterLaminas\FormLaminas\NavigationLaminas\FilterLaminas\HydratorLaminas\InputFilterLaminas\PaginatorLaminas\LogLaminas\ValidatorLaminas\Mvc\Plugin\FlashMessengerLaminas\Mvc\Plugin\IdentityLaminas\ApiToolsLaminas\ApiTools\DocumentationLaminas\ApiTools\Documentation\SwaggerLaminas\ApiTools\ApiProblemLaminas\ApiTools\ConfigurationLaminas\ApiTools\OAuth2Laminas\ApiTools\MvcAuthLaminas\ApiTools\HalLaminas\ApiTools\ContentNegotiationLaminas\ApiTools\ContentValidationLaminas\ApiTools\RestLaminas\ApiTools\RpcLaminas\ApiTools\VersioningApiLmcCorsAssetManagerZfcTwigBjyAuthorizeJield\AuthorizeDoctrineModuleDoctrineORMModuleApplicationContentGeneralClusterNewsContactQualityProjectEvaluationPressProgramSearchAdminLaminasBootstrap5AffiliationOrganisationPublicationInvoiceDeeplinkEventCalendarMailingLaminasGoogleAnalyticsAccountingErrorHeroModuleCirclicalRecaptchaSlmQueueSlmQueueDoctrineLaminas\DeveloperTools
Request and Response 200 NodeController::node on content-route-1
Status code 200 Method GET Controller Content\Controller\NodeController Action node Other Route Parameters
^ array:1 [
  "docRef" => "scope-and-research-areas"
]
Route content-route-1 Template layout/layout

  content: string

Template content/node/node

  node: Content\Entity\Node

Execution Time 380.33 ms
1. route 96.40 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
2. authentication 99.81 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
3. authentication.post 100.05 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
4. authorization 100.22 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
5. authorization.post 100.39 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
6. dispatch 149.39 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
7. dispatch 149.79 ms
File: src/DispatchListener.php - Line: 132
Target: Content\Controller\NodeController
8. render 152.97 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
9. renderer 166.55 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
10. renderer.post 166.64 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
11. renderer 166.70 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
12. renderer.post 166.74 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
13. isAllowed 363.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
14. isAllowed 363.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
15. isAllowed 363.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
16. isAllowed 363.92 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
17. isAllowed 364.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
18. isAllowed 364.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
19. isAllowed 364.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
20. isAllowed 364.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
21. isAllowed 364.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
22. isAllowed 364.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
23. isAllowed 364.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
24. isAllowed 364.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
25. isAllowed 364.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
26. isAllowed 364.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
27. isAllowed 364.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
28. isAllowed 364.63 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
29. isAllowed 364.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
30. isAllowed 364.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
31. isAllowed 364.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
32. isAllowed 364.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
33. isAllowed 364.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
34. isAllowed 364.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
35. isAllowed 365.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
36. isAllowed 365.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
37. isAllowed 365.13 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
38. isAllowed 365.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
39. isAllowed 365.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
40. isAllowed 365.31 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
41. isAllowed 365.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
42. isAllowed 365.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
43. isAllowed 365.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
44. isAllowed 365.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
45. isAllowed 365.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
46. isAllowed 365.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
47. isAllowed 365.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
48. isAllowed 365.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
49. isAllowed 365.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
50. isAllowed 365.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
51. isAllowed 365.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
52. isAllowed 365.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
53. isAllowed 366.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
54. isAllowed 366.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
55. isAllowed 366.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
56. isAllowed 366.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
57. isAllowed 366.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
58. isAllowed 366.32 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
59. isAllowed 366.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
60. isAllowed 366.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
61. isAllowed 366.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
62. isAllowed 366.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
63. isAllowed 366.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
64. isAllowed 366.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
65. isAllowed 366.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
66. isAllowed 366.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
67. isAllowed 366.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
68. isAllowed 366.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
69. isAllowed 366.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
70. isAllowed 366.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
71. isAllowed 367.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
72. isAllowed 367.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
73. isAllowed 367.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
74. isAllowed 367.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
75. isAllowed 367.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
76. isAllowed 367.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
77. isAllowed 368.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
78. isAllowed 368.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
79. isAllowed 368.32 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
80. isAllowed 368.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
81. isAllowed 368.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
82. isAllowed 368.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
83. isAllowed 368.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
84. isAllowed 368.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
85. isAllowed 368.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
86. isAllowed 368.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
87. isAllowed 369.14 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
88. isAllowed 369.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
89. isAllowed 369.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
90. isAllowed 369.54 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
91. isAllowed 369.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
92. isAllowed 369.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
93. isAllowed 369.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
94. isAllowed 369.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
95. isAllowed 370.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
96. isAllowed 370.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
97. isAllowed 370.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
98. isAllowed 370.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
99. isAllowed 370.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
100. isAllowed 370.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
101. isAllowed 370.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
102. isAllowed 370.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
103. isAllowed 370.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
104. isAllowed 371.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
105. isAllowed 371.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
106. isAllowed 371.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
107. isAllowed 371.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
108. isAllowed 371.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
109. isAllowed 371.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
110. isAllowed 371.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
111. isAllowed 371.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
112. isAllowed 372.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
113. isAllowed 372.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
114. isAllowed 372.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
115. isAllowed 372.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
116. isAllowed 372.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
117. isAllowed 372.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
118. isAllowed 372.63 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
119. isAllowed 372.68 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
120. isAllowed 372.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
121. isAllowed 373.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
122. isAllowed 373.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
123. isAllowed 373.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
124. isAllowed 373.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
125. isAllowed 373.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
126. isAllowed 373.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
127. isAllowed 373.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
128. isAllowed 373.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
129. isAllowed 373.83 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
130. isAllowed 373.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
131. isAllowed 374.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
132. isAllowed 374.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
133. isAllowed 374.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
134. isAllowed 374.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
135. isAllowed 374.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
136. isAllowed 374.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
137. isAllowed 374.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
138. isAllowed 375.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
139. isAllowed 375.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
140. isAllowed 375.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
141. isAllowed 375.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
142. isAllowed 375.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
143. isAllowed 375.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
144. isAllowed 375.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
145. isAllowed 375.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
146. isAllowed 375.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
147. isAllowed 375.57 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
148. isAllowed 375.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
149. isAllowed 375.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
150. isAllowed 375.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
151. isAllowed 375.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
152. isAllowed 375.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
153. isAllowed 375.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
154. isAllowed 375.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
155. isAllowed 376.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
156. isAllowed 376.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
157. isAllowed 376.18 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
158. isAllowed 376.23 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
159. isAllowed 376.31 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
160. isAllowed 376.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
161. isAllowed 376.42 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
162. isAllowed 376.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
163. isAllowed 376.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
164. isAllowed 376.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
165. isAllowed 376.65 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
166. isAllowed 376.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
167. isAllowed 376.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
168. isAllowed 376.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
169. isAllowed 376.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
170. isAllowed 376.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
171. isAllowed 377.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
172. isAllowed 377.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
173. isAllowed 377.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
174. isAllowed 377.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
175. isAllowed 377.23 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
176. isAllowed 377.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
177. isAllowed 377.35 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
178. isAllowed 377.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
179. isAllowed 377.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
180. isAllowed 377.52 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
181. isAllowed 377.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
182. isAllowed 377.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
183. isAllowed 377.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
184. isAllowed 377.74 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
185. isAllowed 377.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
186. isAllowed 377.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
187. isAllowed 377.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
188. isAllowed 377.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
189. isAllowed 378.03 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
190. isAllowed 378.08 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
191. response 379.41 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
192. finish 379.52 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
193. collected 877.35 ms
File: Listener/ProfilerListener.php - Line: 86
Target: NULL
Total Time 380.33 ms
Memory Peak 2.00 MB
1. route 2.00 MB

public/index.php - Line: 31

2. authentication 2.00 MB

src/EventManager.php - Line: 319

3. authentication.post 2.00 MB

src/EventManager.php - Line: 319

4. authorization 2.00 MB

src/EventManager.php - Line: 319

5. authorization.post 2.00 MB

src/EventManager.php - Line: 319

6. dispatch 2.00 MB

public/index.php - Line: 31

7. dispatch 2.00 MB

src/DispatchListener.php - Line: 132

8. render 2.00 MB

src/Application.php - Line: 341

9. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

10. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

11. renderer 2.00 MB

src/View.php - Line: 222

12. renderer.post 2.00 MB

src/View.php - Line: 222

13. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

14. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

15. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

16. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

17. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

18. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

19. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

20. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

21. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

22. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

23. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

24. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

25. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

26. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

27. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

28. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

29. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

30. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

31. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

32. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

33. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

34. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

35. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

36. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

37. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

38. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

39. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

40. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

41. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

42. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

43. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

44. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

45. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

46. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

47. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

48. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

49. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

50. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

51. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

52. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

53. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

54. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

55. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

56. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

57. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

58. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

59. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

60. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

61. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

62. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

63. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

64. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

65. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

66. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

67. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

68. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

69. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

70. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

71. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

72. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

73. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

74. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

75. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

76. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

77. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

78. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

79. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

80. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

81. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

82. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

83. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

84. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

85. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

86. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

87. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

88. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

89. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

90. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

91. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

92. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

93. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

94. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

95. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

96. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

97. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

98. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

99. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

100. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

101. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

102. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

103. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

104. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

105. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

106. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

107. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

108. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

109. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

110. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

111. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

112. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

113. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

114. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

115. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

116. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

117. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

118. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

119. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

120. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

121. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

122. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

123. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

124. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

125. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

126. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

127. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

128. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

129. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

130. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

131. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

132. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

133. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

134. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

135. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

136. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

137. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

138. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

139. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

140. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

141. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

142. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

143. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

144. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

145. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

146. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

147. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

148. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

149. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

150. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

151. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

152. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

153. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

154. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

155. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

156. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

157. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

158. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

159. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

160. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

161. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

162. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

163. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

164. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

165. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

166. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

167. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

168. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

169. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

170. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

171. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

172. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

173. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

174. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

175. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

176. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

177. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

178. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

179. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

180. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

181. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

182. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

183. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

184. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

185. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

186. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

187. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

188. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

189. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

190. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

191. response 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

192. finish 2.00 MB

src/Application.php - Line: 341

193. collected 2.00 MB

Listener/ProfilerListener.php - Line: 86

Memory Peak 2.00 MB
Config Config
Merged Config (Config)
^ array:66 [
  "service_manager" => array:7 [
    "abstract_factories" => array:11 [
      0 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      1 => "Laminas\Form\FormAbstractServiceFactory"
      2 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      3 => "Laminas\Log\LoggerAbstractServiceFactory"
      4 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      6 => "Laminas\ApiTools\DbConnectedResourceAbstractFactory"
      7 => "Laminas\ApiTools\TableGatewayAbstractFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      8 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      9 => "Laminas\Log\LoggerAbstractServiceFactory"
    ]
    "factories" => array:731 [
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\Navigation\Navigation" => "Laminas\Navigation\Service\DefaultNavigationFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "Laminas\ApiTools\MvcAuth\UnauthenticatedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\UnauthorizedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\Factory\ApiFactoryFactory"
      "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategyFactory"
      "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Factory\RenderErrorListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Factory\SendApiProblemResponseListenerFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemRendererFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemStrategyFactory"
      "Laminas\ApiTools\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\Factory\ConfigResourceFactory"
      "Laminas\ApiTools\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\Factory\ResourceFactoryFactory"
      "Laminas\ApiTools\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\Factory\ConfigWriterFactory"
      "Laminas\ApiTools\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\Factory\ModuleUtilsFactory"
      "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter" => "Application\Authentication\Factory\PdoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Factory\MongoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationServiceFactory"
      "Laminas\ApiTools\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\MvcAuth\Factory\NamedOAuth2ServerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication" => "Laminas\ApiTools\MvcAuth\Factory\AuthenticationServiceFactory"
      "Laminas\ApiTools\MvcAuth\ApacheResolver" => "Laminas\ApiTools\MvcAuth\Factory\ApacheResolverFactory"
      "Laminas\ApiTools\MvcAuth\FileResolver" => "Laminas\ApiTools\MvcAuth\Factory\FileResolverFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthenticationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\AuthHttpAdapter" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthHttpAdapterFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization" => "Laminas\ApiTools\MvcAuth\Factory\AclAuthorizationFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthorizationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultResourceResolverListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultResourceResolverListenerFactory"
      "Laminas\Authentication\Storage\NonPersistent" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Factory\LinkExtractorFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Factory\LinkCollectionExtractorFactory"
      "Laminas\ApiTools\Hal\HalConfig" => "Laminas\ApiTools\Hal\Factory\HalConfigFactory"
      "Laminas\ApiTools\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\Factory\HalJsonRendererFactory"
      "Laminas\ApiTools\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\Factory\HalJsonStrategyFactory"
      "Laminas\ApiTools\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Factory\LinkUrlBuilderFactory"
      "Laminas\ApiTools\Hal\MetadataMap" => "Laminas\ApiTools\Hal\Factory\MetadataMapFactory"
      "Laminas\ApiTools\Hal\RendererOptions" => "Laminas\ApiTools\Hal\Factory\RendererOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentTypeFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentNegotiationOptions" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentNegotiationOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\HttpMethodOverrideListener" => "Laminas\ApiTools\ContentNegotiation\Factory\HttpMethodOverrideListenerFactory"
      "Laminas\ApiTools\ContentValidation\ContentValidationListener" => "Laminas\ApiTools\ContentValidation\ContentValidationListenerFactory"
      "Laminas\ApiTools\Rest\OptionsListener" => "Laminas\ApiTools\Rest\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Rpc\OptionsListener" => "Laminas\ApiTools\Rpc\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\Factory\ContentTypeListenerFactory"
      "Laminas\ApiTools\Versioning\VersionListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Api\V1\Rest\ContactResource\MeListener" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "LmcCors\Mvc\CorsRequestListener" => "LmcCors\Factory\CorsRequestListenerFactory"
      "LmcCors\Options\CorsOptions" => "LmcCors\Factory\CorsOptionsFactory"
      "LmcCors\Service\CorsService" => "LmcCors\Factory\CorsServiceFactory"
      "AssetManager\Service\AssetManager" => "AssetManager\Service\AssetManagerServiceFactory"
      "AssetManager\Service\AssetFilterManager" => "AssetManager\Service\AssetFilterManagerServiceFactory"
      "AssetManager\Service\AssetCacheManager" => "AssetManager\Service\AssetCacheManagerServiceFactory"
      "AssetManager\Resolver\AggregateResolver" => "AssetManager\Service\AggregateResolverServiceFactory"
      "AssetManager\Resolver\MapResolver" => "AssetManager\Service\MapResolverServiceFactory"
      "AssetManager\Resolver\PathStackResolver" => "AssetManager\Service\PathStackResolverServiceFactory"
      "AssetManager\Resolver\PrioritizedPathsResolver" => "AssetManager\Service\PrioritizedPathsResolverServiceFactory"
      "AssetManager\Resolver\CollectionResolver" => "AssetManager\Service\CollectionResolverServiceFactory"
      "AssetManager\Resolver\ConcatResolver" => "AssetManager\Service\ConcatResolverServiceFactory"
      "AssetManager\Resolver\AliasPathStackResolver" => "AssetManager\Service\AliasPathStackResolverServiceFactory"
      "Twig\Environment" => "ZfcTwig\Twig\EnvironmentFactory"
      "Twig\Loader\ChainLoader" => "ZfcTwig\Twig\ChainLoaderFactory"
      "ZfcTwig\Twig\Extension" => "ZfcTwig\Twig\ExtensionFactory"
      "ZfcTwig\Twig\MapLoader" => "ZfcTwig\Twig\MapLoaderFactory"
      "ZfcTwig\Twig\StackLoader" => "ZfcTwig\Twig\StackLoaderFactory"
      "ZfcTwig\View\TwigRenderer" => "ZfcTwig\View\TwigRendererFactory"
      "ZfcTwig\View\TwigResolver" => "ZfcTwig\View\TwigResolverFactory"
      "ZfcTwig\View\HelperPluginManager" => "ZfcTwig\View\HelperPluginManagerFactory"
      "ZfcTwig\View\TwigStrategy" => "ZfcTwig\View\TwigStrategyFactory"
      "ZfcTwig\ModuleOptions" => "ZfcTwig\ModuleOptionsFactory"
      "BjyAuthorize\Cache" => "BjyAuthorize\Service\CacheFactory"
      "BjyAuthorize\CacheKeyGenerator" => "BjyAuthorize\Service\CacheKeyGeneratorFactory"
      "BjyAuthorize\Config" => "Jield\Authorize\Factory\ConfigServiceFactory"
      "BjyAuthorize\Guards" => "BjyAuthorize\Service\GuardsServiceFactory"
      "BjyAuthorize\RoleProviders" => "BjyAuthorize\Service\RoleProvidersServiceFactory"
      "BjyAuthorize\ResourceProviders" => "BjyAuthorize\Service\ResourceProvidersServiceFactory"
      "BjyAuthorize\RuleProviders" => "BjyAuthorize\Service\RuleProvidersServiceFactory"
      "BjyAuthorize\Service\RoleDbTableGateway" => "BjyAuthorize\Service\UserRoleServiceFactory"
      "BjyAuthorize\Collector\RoleCollector" => "BjyAuthorize\Service\RoleCollectorServiceFactory"
      "BjyAuthorize\Guard\Controller" => "BjyAuthorize\Service\ControllerGuardServiceFactory"
      "BjyAuthorize\Guard\Route" => "BjyAuthorize\Service\RouteGuardServiceFactory"
      "BjyAuthorize\Provider\Identity\AuthenticationIdentityProvider" => "BjyAuthorize\Service\AuthenticationIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\LmcUserLaminasDb" => "BjyAuthorize\Service\LmcUserLaminasDbIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\ProviderInterface" => "BjyAuthorize\Service\IdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Resource\Config" => "BjyAuthorize\Service\ConfigResourceProviderServiceFactory"
      "BjyAuthorize\Provider\Role\Config" => "BjyAuthorize\Service\ConfigRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\LaminasDb" => "BjyAuthorize\Service\LaminasDbRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\ObjectRepositoryProvider" => "BjyAuthorize\Service\ObjectRepositoryRoleProviderFactory"
      "BjyAuthorize\Provider\Rule\Config" => "BjyAuthorize\Service\ConfigRuleProviderServiceFactory"
      "BjyAuthorize\Service\Authorize" => "BjyAuthorize\Service\AuthorizeFactory"
      "BjyAuthorize\View\UnauthorizedStrategy" => "BjyAuthorize\Service\UnauthorizedStrategyServiceFactory"
      "Jield\Authorize\View\UnauthorizedStrategy" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Jield\Authorize\Service\AuthorizeService" => "Jield\Authorize\Factory\AuthorizeServiceFactory"
      "Jield\Authorize\Service\AssertionService" => "Jield\Authorize\Factory\AssertionServiceFactory"
      "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider" => "Jield\Authorize\Factory\AuthenticationIdentityProviderFactory"
      "Jield\Authorize\Rule\RulesWithAssertion" => "Jield\Authorize\Factory\RuleWithAssertionFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "doctrine.cache.application_cache" => "Application\Factory\StorageCacheFactory"
      "Laminas\Cache\Storage\Adapter\Redis" => "Application\Factory\LaminasCacheFactory"
      "Application\Event\InjectAclInNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\SetTitle" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Application\Event\BlockInactiveContact" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\RegisterPageview" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\I18n\Translator\TranslatorInterface" => "Application\Factory\TranslatorServiceFactory"
      "Application\Service\FormService" => "Application\Factory\FormServiceFactory"
      "Application\Options\ModuleOptions" => "Application\Factory\ModuleOptionsFactory"
      "Application\Authentication\Storage\AuthenticationStorage" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Authentication\AuthenticationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Session\SaveHandler\DoctrineGateway" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Twig\DatabaseTwigLoader" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "cms_navigation" => "Content\Navigation\Factory\ContentNavigationFactory"
      "Content\Service\ContentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\NodeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\VimeoService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\ArticleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\RouteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Event\InitRoutes" => "Application\Factory\InvokableFactory"
      "Content\InputFilter\HandlerFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\RouteFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\SegmentFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TopicFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Options\ModuleOptions" => "Content\Factory\ModuleOptionsFactory"
      "Content\Navigation\Service\ContentNavigationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ContentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\HandlerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\NodeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ParamLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\RouteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\SegmentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Content\Acl\Assertion\Node" => "Application\Factory\InvokableFactory"
      "General\Options\ModuleOptions" => "General\Factory\ModuleOptionsFactory"
      "General\Options\EmailOptions" => "General\Factory\EmailOptionsFactory"
      "General\InputFilter\ChallengeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\Challenge\TypeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\CountryFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\GenderFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\LanguageFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\ExchangeRateFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\TitleFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\WebInfoFilter" => "Application\Factory\InputFilterFactory"
      "General\Service\GeneralService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\CountryService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\EmailService" => "Application\Factory\InvokableFactory"
      "General\Search\Service\CountrySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Mail\Transport\Smtp" => "General\Factory\SmtpTransportFactory"
      "Laminas\Mail\Transport\Sendmail" => "General\Factory\SendmailTransportFactory"
      "Mailjet\Client" => "General\Factory\MailjetClientFactory"
      "General\Navigation\Invokable\ChallengeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ChallengeTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ContentTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\EmailMessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\Country\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LanguageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CurrencyLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\PasswordLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\GenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\TitleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\WebInfoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Cluster\Command\UpdateProject" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Command\GenerateProjectJson" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Options\ModuleOptions" => "Cluster\Factory\ModuleOptionsFactory"
      "Cluster\Acl\Assertion\ClusterAssertion" => "Application\Factory\InvokableFactory"
      "Cluster\Form\ClusterForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\InputFilter\ClusterFilter" => "Application\Factory\InputFilterFactory"
      "Cluster\Service\ClusterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Navigation\Invokable\ClusterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Service\NewsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\BlogService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\MagazineService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\InputFilter\Blog\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\Blog\TagFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\News\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\MagazineFilter" => "Application\Factory\InputFilterFactory"
      "News\Acl\Assertion\Magazine" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Magazine\Article" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Blog" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\News" => "Application\Factory\InvokableFactory"
      "News\Search\Service\NewsSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Search\Service\BlogSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Navigation\Invokable\BlogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\TagLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\NewsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\News\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\MagazineLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Magazine\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Command\ResetAccess" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Provider\ContactProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Contact\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\FacebookLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\OptInLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\AddressLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\DndLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\NoteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\PhoneLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Selection\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\LeaveLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\SelectionContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\AddressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\Office\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\ContactForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\InputFilter\AddressFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\PhoneFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\FacebookFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\DndFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\OptInFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Selection\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\LeaveFilter" => "Application\Factory\InputFilterFactory"
      "Contact\Search\Service\ContactSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Search\Service\ProfileSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Acl\Assertion\Address" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Profile" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Facebook" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Note" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Phone" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Selection" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\ContactAssertion" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\LeaveAssertion" => "Application\Factory\InvokableFactory"
      "Quality\Service\QualityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\Navigation\Invokable\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\SourceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\PhaseLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\YearLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\KpiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\PhaseFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\YearFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\KpiFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\TargetFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\Provider\ProjectProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Provider\Version\VersionProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Acl\Assertion\ChangeRequest\CostChange" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Country" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Process" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Description\Description" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Document\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool\Session" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Idea" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Image" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Partner" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Video" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Poster\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Item" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WorkpackageDescription" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Report" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WindowAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Window\ProjectAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Result\Result" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Version" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Task" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Workpackage" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResultAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\LinkAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\DocumentAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Action" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Pca" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Help" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\HelpFaq" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Log" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Project" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Rationale" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Roadmap" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Calendar\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Project\Service\ProjectService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\KeywordService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AchievementService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Achievement\ExploitableResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionDocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Report\WindowService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\WorkpackageService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ContractService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DescriptionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\IdeaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\Tool\SessionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\HelpService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\InviteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ChangeRequestService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ActionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AwardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\EventService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\ProjectForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\Deliverable\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DeliverableFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\TaskFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AchievementFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\ExploitableResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ProjectFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Action\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AwardFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Award\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CostChangeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Document\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Description\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Event\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\ReportFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\WorkpackageDescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\RationaleFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\Version\VersionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\IdeaFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\ToolFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Description\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Tool\SessionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\FeeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\LogFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\HelpFilter" => "Application\Factory\InputFilterFactory"
      "Project\Options\ModuleOptions" => "Project\Factory\ModuleOptionsFactory"
      "Project\Navigation\Service\HelpNavigationService" => "Project\Navigation\Factory\HelpNavigationServiceFactory"
      "Project\Navigation\Invokable\AchievementLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinkLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinksLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Link\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Document\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\AwardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Award\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CostChangeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\RationaleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Document\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ContractLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Contract\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\FeeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpFaqLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\IdeaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\ToolLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Tool\SessionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Description\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PartnerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Meeting\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Poster\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\ItemLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WorkpackageDescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\Type\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Version\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\WorkpackageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\TaskLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DeliverableLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CalendarReviewLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Search\Service\AchievementSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\Achievement\ExploitableResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\IdeaSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\DescriptionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ProjectSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\WorkpackageDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ActionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Acl\Assertion\FeedbackAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\EvaluationAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReportAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\InputFilter\Report\Criterion\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TopicFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\Service\EvaluationReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\EvaluationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewRosterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewerService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\CriterionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Reviewer\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluateProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\FeedbackLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Options\ModuleOptions" => "Evaluation\Options\Factory\ModuleOptionsFactory"
      "Press\Service\PressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Search\Service\PressSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Press\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Press\Navigation\Invokable\BureauLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Service\ProgramService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\Service\CallService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\ProgramFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\FunderFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CallFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Program\Options\ModuleOptions" => "Program\Factory\ModuleOptionsFactory"
      "Program\Acl\Assertion\Doa" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Funder" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Nda" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Call\Country" => "Application\Factory\InvokableFactory"
      "Program\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Program\Navigation\Invokable\CallLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\FunderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\NdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\ProgramLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\UploadNdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Search\Command\UpdateIndex" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Search\Service\ConsoleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\AdminService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\QueueService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\ApiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\OAuth2Service" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\InputFilter\AccessFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Navigation\Invokable\AccessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ClientLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ScopeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\EntityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\RoleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\SetterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Api\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\QueueLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Provider\AffiliationProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\AffiliationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\QuestionnaireService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\DoaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\LoiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\InputFilter\AffiliationFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\Options\ModuleOptions" => "Affiliation\Factory\ModuleOptionsFactory"
      "Affiliation\Acl\Assertion\AffiliationAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\LoiAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\QuestionnaireAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Navigation\Invokable\AffiliationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\LoiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionnaireLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Options\ModuleOptions" => "Organisation\Factory\ModuleOptionsFactory"
      "Organisation\Form\OrganisationForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\CityForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\SolutionForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\UpdateForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\FinancialForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\OrganisationService" => "Application\Factory\InvokableFactory"
      "Organisation\Service\UpdateService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\BoardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\CityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\SolutionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\ParentService" => "Application\Factory\InvokableFactory"
      "Organisation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\BoardFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\OrganisationFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\ParentEntityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\Parent\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\CityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\SolutionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\Acl\Assertion\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\NoteAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\ParentAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\UpdateAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\FinancialAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\CityAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\SolutionAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Search\Service\OrganisationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Navigation\Invokable\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\BoardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\ParentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\UpdateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\FinancialLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\CityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\SolutionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Service\PublicationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\InputFilter\PublicationFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Publication\Search\Service\PublicationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\Acl\Assertion\Publication" => "Application\Factory\InvokableFactory"
      "Publication\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Publication\Navigation\Invokable\PublicationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeCategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Command\DailyUpdate" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Command\Sync" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\TransactionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\InvoiceService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Options\ModuleOptions" => "Invoice\Factory\ModuleOptionsFactory"
      "Invoice\Search\Service\InvoiceSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Acl\Assertion\Invoice" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Journal" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Method" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Pdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Reminder" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\ReminderPdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Row" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Transaction" => "Application\Factory\InvokableFactory"
      "Invoice\Navigation\Invokable\InvoiceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\JournalLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\TransactionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\ReminderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\RowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\VatDimensionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Deeplink\Service\DeeplinkService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\InputFilter\TargetFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Command\CancelPaymentPending" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Command\UpdateRegistrations" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Navigation\Invokable\BoothLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BoothSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskCostsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\CouponLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationDeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingQuotaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingFloorplanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\TicketLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Service\BadgeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\BoothService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\RegistrationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionFloorplanService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionSpecService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\InputFilter\Badge\AttachmentFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\DeskCostsFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\QuotaFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\OptionCostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\ExhibitionFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\SpecFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Booth\BoothFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\RegistrationFilter" => "Application\Factory\InputFilterFactory"
      "Event\Options\ModuleOptions" => "Event\Factory\ModuleOptionsFactory"
      "Event\Options\CometChatApiOptions" => "Event\Factory\CometChatApiOptionsFactory"
      "Event\Search\Service\RegistrationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Acl\Assertion\Badge" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Booth" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\BoothSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Exhibition" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\ExhibitionSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Meeting" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\MeetingFloorplan" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Registration" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Ticket" => "Application\Factory\InvokableFactory"
      "Calendar\Service\CalendarService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Options\ModuleOptions" => "Calendar\Factory\ModuleOptionsFactory"
      "Calendar\Acl\Assertion\Calendar" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Document" => "Application\Factory\InvokableFactory"
      "Calendar\Search\Service\CalendarSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Navigation\Invokable\CalendarLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Calendar\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Command\FlushQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Command\SendQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Service\MailingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\MailingFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\SenderFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Navigation\Invokable\MailingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\SenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "LaminasGoogleAnalytics\Analytics\Tracker" => "LaminasGoogleAnalytics\Service\TrackerFactory"
      "LaminasGoogleAnalytics\Service\ScriptFactory" => "LaminasGoogleAnalytics\Service\ScriptFactory"
      "Accounting\Adapter\TwinfieldAdapter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Accounting\Options\ModuleOptions" => "Accounting\Factory\ModuleOptionsFactory"
      "ErrorHeroModule\Listener\Mvc" => "ErrorHeroModule\Listener\MvcFactory"
      "ErrorHeroModule\Handler\Logging" => "ErrorHeroModule\Handler\LoggingFactory"
      "SlmQueue\Job\JobPluginManager" => "SlmQueue\Factory\JobPluginManagerFactory"
      "SlmQueue\Strategy\StrategyPluginManager" => "SlmQueue\Factory\StrategyPluginManagerFactory"
      "SlmQueue\Queue\QueuePluginManager" => "SlmQueue\Factory\QueuePluginManagerFactory"
      "SlmQueue\Worker\WorkerPluginManager" => "SlmQueue\Factory\WorkerPluginManagerFactory"
      "SlmQueue\Command\StartWorkerCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
      "SlmQueueDoctrine\Command\RecoverJobsCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
    ]
    "aliases" => array:81 [
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "navigation" => "Laminas\Navigation\Navigation"
      "Zend\Navigation\Navigation" => "Laminas\Navigation\Navigation"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
      "ZF\Apigility\MvcAuth\UnauthenticatedListener" => "Laminas\ApiTools\MvcAuth\UnauthenticatedListener"
      "ZF\Apigility\MvcAuth\UnauthorizedListener" => "Laminas\ApiTools\MvcAuth\UnauthorizedListener"
      "ZF\Apigility\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\ApiFactory"
      "ZF\Apigility\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy"
      "Laminas\ApiTools\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "Laminas\ApiTools\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "Laminas\ApiTools\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "Laminas\ApiTools\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\ApiProblemListener"
      "ZF\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\RenderErrorListener"
      "ZF\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\ApiProblemRenderer"
      "ZF\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\ApiProblemStrategy"
      "ZF\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "ZF\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "ZF\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener"
      "ZF\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "ZF\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\ConfigResource"
      "ZF\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\ConfigResourceFactory"
      "ZF\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\ConfigWriter"
      "ZF\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\ModuleUtils"
      "Laminas\ApiTools\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId"
      "ZF\OAuth2\Adapter\PdoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
      "ZF\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter"
      "ZF\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\OAuth2\Service\OAuth2Server"
      "authentication" => "Laminas\ApiTools\MvcAuth\Authentication"
      "authorization" => "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface"
      "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface" => "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization"
      "ZF\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkExtractor"
      "ZF\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor"
      "ZF\Hal\HalConfig" => "Laminas\ApiTools\Hal\HalConfig"
      "ZF\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\JsonRenderer"
      "ZF\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\JsonStrategy"
      "ZF\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Link\LinkUrlBuilder"
      "ZF\Hal\MetadataMap" => "Laminas\ApiTools\Hal\MetadataMap"
      "ZF\Hal\RendererOptions" => "Laminas\ApiTools\Hal\RendererOptions"
      "ZF\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\AcceptListener"
      "ZF\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\ContentTypeListener"
      "ZF\Versioning\VersionListener" => "Laminas\ApiTools\Versioning\VersionListener"
      "mime_resolver" => "AssetManager\Service\MimeResolver"
      "AssetManager\Service\AggregateResolver" => "AssetManager\Resolver\AggregateResolver"
      "ZfcTwigExtension" => "ZfcTwig\Twig\Extension"
      "ZfcTwigLoaderChain" => "Twig\Loader\ChainLoader"
      "ZfcTwigLoaderTemplateMap" => "ZfcTwig\Twig\MapLoader"
      "ZfcTwigLoaderTemplatePathStack" => "ZfcTwig\Twig\StackLoader"
      "ZfcTwigRenderer" => "ZfcTwig\View\TwigRenderer"
      "ZfcTwigResolver" => "ZfcTwig\View\TwigResolver"
      "ZfcTwigViewHelperManager" => "ZfcTwig\View\HelperPluginManager"
      "ZfcTwigViewStrategy" => "ZfcTwig\View\TwigStrategy"
      "bjyauthorize_zend_db_adapter" => "Laminas\Db\Adapter\Adapter"
      "BjyAuthorize\Service\Authorize" => "Jield\Authorize\Service\AuthorizeService"
      "BjyAuthorize\Cache" => "Laminas\Cache\Storage\Adapter\Redis"
      "google-analytics" => "LaminasGoogleAnalytics\Analytics\Tracker"
      "google-analytics-universal" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "google-analytics-ga" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "delegators" => array:2 [
      "ViewHelperManager" => array:1 [ …1]
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => array:1 [ …1]
    ]
    "invokables" => array:44 [
      "Laminas\ApiTools\Rest\RestParametersListener" => "Laminas\ApiTools\Rest\Listener\RestParametersListener"
      "AssetManager\Service\MimeResolver" => "AssetManager\Service\MimeResolver"
      0 => "BjyAuthorize\View\RedirectionStrategy"
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
      "Content\InputFilter\ArticleFilter" => "Content\InputFilter\ArticleFilter"
      "Content\InputFilter\ContentFilter" => "Content\InputFilter\ContentFilter"
      "Content\InputFilter\ContentParamFilter" => "Content\InputFilter\ContentParamFilter"
      "Content\InputFilter\NodeFilter" => "Content\InputFilter\NodeFilter"
      "Content\InputFilter\ParamFilter" => "Content\InputFilter\ParamFilter"
      1 => "General\InputFilter\PasswordFilter"
      2 => "Cluster\Provider\ClusterProvider"
      3 => "News\InputFilter\NewsFilter"
      4 => "News\InputFilter\BlogFilter"
      5 => "News\InputFilter\Blog\MessageFilter"
      6 => "News\InputFilter\Magazine\ArticleFilter"
      7 => "Press\InputFilter\ArticleFilter"
      8 => "Press\InputFilter\BureauFilter"
      9 => "Program\InputFilter\Call\CallFilter"
      10 => "Program\InputFilter\Call\CountryFilter"
      11 => "Program\InputFilter\DoaFilter"
      12 => "Program\InputFilter\FunderFilter"
      13 => "Admin\InputFilter\Permit\RoleFilter"
      14 => "Organisation\InputFilter\NoteFilter"
      15 => "Invoice\InputFilter\InvoiceFilter"
      16 => "Invoice\InputFilter\RowFilter"
      "Calendar\InputFilter\CalendarFilter" => "Calendar\InputFilter\CalendarFilter"
      "Calendar\InputFilter\DocumentFilter" => "Calendar\InputFilter\DocumentFilter"
      "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "LaminasGoogleAnalytics\View\Helper\Script\Gajs" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "initializers" => array:1 [
      0 => "BjyAuthorize\Service\AuthorizeAwareServiceInitializer"
    ]
    "shared" => array:1 [
      "Contact\Service\ContactService" => false
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:15 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
      "cluster:update-project" => "Cluster\Command\UpdateProject"
      "cluster:generate-project-json" => "Cluster\Command\GenerateProjectJson"
      "contact:cleanup" => "Contact\Command\Cleanup"
      "contact:reset-access" => "Contact\Command\ResetAccess"
      "search:update-index" => "Search\Command\UpdateIndex"
      "organisation:cleanup" => "Organisation\Command\Cleanup"
      "invoice:sync" => "Invoice\Command\Sync"
      "invoice:daily-update" => "Invoice\Command\DailyUpdate"
      "event:update-registrations" => "Event\Command\UpdateRegistrations"
      "event:cancel-payment-pending" => "Event\Command\CancelPaymentPending"
      "mailing:send-queue" => "Mailing\Command\SendQueue"
      "mailing:flush-queue" => "Mailing\Command\FlushQueue"
      "slm-queue:start" => "SlmQueue\Command\StartWorkerCommand"
      "slm-queue:doctrine:recover" => "SlmQueueDoctrine\Command\RecoverJobsCommand"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:28 [
      "api-tools" => array:4 [ …4]
      "oauth" => array:4 [ …4]
      "api" => array:4 [ …4]
      "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
      "doctrine_orm_module_yuml" => array:2 [ …2]
      "zfcadmin" => array:5 [ …5]
      "home" => array:3 [ …3]
      "my" => array:3 [ …3]
      "redirect" => array:5 [ …5]
      "image" => array:4 [ …4]
      "country" => array:5 [ …5]
      "impact-stream" => array:5 [ …5]
      "challenge" => array:4 [ …4]
      "email" => array:5 [ …5]
      "community" => array:5 [ …5]
      "magazine" => array:4 [ …4]
      "annual-report" => array:4 [ …4]
      "json" => array:4 [ …4]
      "assets" => array:4 [ …4]
      "project" => array:5 [ …5]
      "press" => array:4 [ …4]
      "search" => array:3 [ …3]
      "oauth2" => array:4 [ …4]
      "user" => array:5 [ …5]
      "organisation" => array:5 [ …5]
      "publication" => array:5 [ …5]
      "deeplink" => array:3 [ …3]
      "error-preview" => array:2 [ …2]
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:504 [
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "agacceptheaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agcontenttypeheaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agservicepath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agstatuscodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agtransformdescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "agTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "ZF\Apigility\Documentation\View\AgAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "ZF\Apigility\Documentation\View\AgContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "ZF\Apigility\Documentation\View\AgServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "ZF\Apigility\Documentation\View\AgStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "ZF\Apigility\Documentation\View\AgTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "asset" => "AssetManager\View\Helper\Asset"
      "nodeLink" => "Content\View\Helper\NodeLink"
      "paramLink" => "Content\View\Helper\ParamLink"
      "handlerLink" => "Content\View\Helper\HandlerLink"
      "segmentLink" => "Content\View\Helper\SegmentLink"
      "templateLink" => "Content\View\Helper\TemplateLink"
      "contentLink" => "Content\View\Helper\ContentLink"
      "routeLink" => "Content\View\Helper\RouteLink"
      "topicLink" => "Content\View\Helper\TopicLink"
      "articleLink" => "Content\View\Helper\ArticleLink"
      "nodeTableRow" => "Content\View\Helper\NodeTableRow"
      "imageLink" => "Content\View\Helper\ImageLink"
      "image" => "Content\View\Helper\Image"
      "videoLink" => "Content\View\Helper\VideoLink"
      "video" => "Content\View\Helper\Video"
      "paginationLink" => "Content\View\Helper\PaginationLink"
      "imageHandler" => "Content\View\Handler\ImageHandler"
      "contentHandler" => "Content\View\Handler\ContentHandler"
      "buildNavigation" => "Content\View\Helper\BuildNavigation"
      "challengeHandler" => "General\View\Handler\ChallengeHandler"
      "challengeIcon" => "General\View\Helper\Challenge\ChallengeIcon"
      "challengeImage" => "General\View\Helper\Challenge\ChallengeImage"
      "challengeIdeaPosterImage" => "General\View\Helper\Challenge\Idea\Poster\Image"
      "challengeIdeaPosterIcon" => "General\View\Helper\Challenge\Idea\Poster\Icon"
      "challengeTypeLink" => "General\View\Helper\Challenge\TypeLink"
      "countryMap" => "General\View\Helper\Country\CountryMap"
      "countryFlag" => "General\View\Helper\Country\CountryFlag"
      "countryLink" => "General\View\Helper\Country\CountryLink"
      "countryVideoLink" => "General\View\Helper\Country\VideoLink"
      "languageLink" => "General\View\Helper\LanguageLink"
      "currencyLink" => "General\View\Helper\CurrencyLink"
      "exchangeRateLink" => "General\View\Helper\ExchangeRateLink"
      "passwordLink" => "General\View\Helper\PasswordLink"
      "emailMessageLink" => "General\View\Helper\EmailMessageLink"
      "generalLogLink" => "General\View\Helper\LogLink"
      "vatLink" => "General\View\Helper\VatLink"
      "genderLink" => "General\View\Helper\GenderLink"
      "titleLink" => "General\View\Helper\TitleLink"
      "vatTypeLink" => "General\View\Helper\VatTypeLink"
      "challengeLink" => "General\View\Helper\Challenge\ChallengeLink"
      "webInfoLink" => "General\View\Helper\WebInfoLink"
      "contentTypeLink" => "General\View\Helper\ContentTypeLink"
      "contentTypeIcon" => "General\View\Helper\ContentTypeIcon"
      "countryselect" => "General\Form\View\Helper\CountrySelect"
      "clusterLink" => "Cluster\View\Helper\ClusterLink"
      "clusterLogo" => "Cluster\View\Helper\Cluster\Logo"
      "blogLink" => "News\View\Helper\BlogLink"
      "blogMessageLink" => "News\View\Helper\Blog\MessageLink"
      "blogTagLink" => "News\View\Helper\Blog\TagLink"
      "blogCategoryLink" => "News\View\Helper\Blog\CategoryLink"
      "newsLink" => "News\View\Helper\NewsLink"
      "newsCategoryLink" => "News\View\Helper\News\CategoryLink"
      "magazineLink" => "News\View\Helper\MagazineLink"
      "magazineArticleLink" => "News\View\Helper\Magazine\ArticleLink"
      "blogselect" => "News\Form\View\Helper\BlogSelect"
      "contactLink" => "Contact\View\Helper\ContactLink"
      "officeContactLink" => "Contact\View\Helper\Office\ContactLink"
      "leaveLink" => "Contact\View\Helper\Office\LeaveLink"
      "dndLink" => "Contact\View\Helper\DndLink"
      "profileLink" => "Contact\View\Helper\ProfileLink"
      "selectionLink" => "Contact\View\Helper\SelectionLink"
      "selectionTypeLink" => "Contact\View\Helper\Selection\TypeLink"
      "facebookLink" => "Contact\View\Helper\FacebookLink"
      "optInLink" => "Contact\View\Helper\OptInLink"
      "addressLink" => "Contact\View\Helper\AddressLink"
      "noteLink" => "Contact\View\Helper\NoteLink"
      "phoneLink" => "Contact\View\Helper\PhoneLink"
      "contactPhoto" => "Contact\View\Helper\ContactPhoto"
      "contactformelement" => "Contact\Form\View\Helper\ContactFormElement"
      "selectionformelement" => "Contact\Form\View\Helper\SelectionFormElement"
      "qualityActionLink" => "Quality\View\Helper\ActionLink"
      "qualityProcessLink" => "Quality\View\Helper\ProcessLink"
      "qualityStatusLink" => "Quality\View\Helper\StatusLink"
      "qualityStatusBadge" => "Quality\View\Helper\StatusBadge"
      "qualityPhaseLink" => "Quality\View\Helper\PhaseLink"
      "qualityYearLink" => "Quality\View\Helper\YearLink"
      "qualityTargetLink" => "Quality\View\Helper\TargetLink"
      "qualityKpiLink" => "Quality\View\Helper\KpiLink"
      "qualityKpiTargetLink" => "Quality\View\Helper\Kpi\TargetLink"
      "qualityKpiGroupLink" => "Quality\View\Helper\Kpi\GroupLink"
      "qualityKpiResultLink" => "Quality\View\Helper\Kpi\ResultLink"
      "qualityKpiResultMatrix" => "Quality\View\Helper\Kpi\Result\Matrix"
      "qualityActionSourceLink" => "Quality\View\Helper\Action\SourceLink"
      "qualityActionGroupLink" => "Quality\View\Helper\Action\GroupLink"
      "qualityActionResultMatrix" => "Quality\View\Helper\Action\Result\Matrix"
      "projectLogo" => "Project\View\Helper\Project\ProjectLogo"
      "projectQuickstart" => "Project\View\Helper\Project\Quickstart"
      "projectStatusIcon" => "Project\View\Helper\Project\StatusIcon"
      "projectDates" => "Project\View\Helper\Project\ProjectDates"
      "projectInviteLink" => "Project\View\Helper\Project\InviteLink"
      "projectSelectionLink" => "Project\View\Helper\SelectionLink"
      "ideaImage" => "Project\View\Helper\Idea\IdeaImage"
      "toolSessionLink" => "Project\View\Helper\Idea\Tool\SessionLink"
      "helpLink" => "Project\View\Helper\HelpLink"
      "logLink" => "Project\View\Helper\LogLink"
      "pcaLink" => "Project\View\Helper\PcaLink"
      "helpFaqLink" => "Project\View\Helper\HelpFaqLink"
      "projectLink" => "Project\View\Helper\Project\ProjectLink"
      "documentLink" => "Project\View\Helper\Document\DocumentLink"
      "documentTypeLink" => "Project\View\Helper\Document\TypeLink"
      "versionLink" => "Project\View\Helper\Version\VersionLink"
      "versionDocumentLink" => "Project\View\Helper\Version\DocumentLink"
      "versionReviewerLink" => "Project\View\Helper\Version\ReviewerLink"
      "resultCategoryLink" => "Project\View\Helper\Result\CategoryLink"
      "resultTypeLink" => "Project\View\Helper\Result\TypeLink"
      "resultLink" => "Project\View\Helper\ResultLink"
      "reportLink" => "Project\View\Helper\Report\ReportLink"
      "reportHelper" => "Project\View\Helper\Report\ReportHelper"
      "reportItemLink" => "Project\View\Helper\Report\ItemLink"
      "reportReviewerLink" => "Project\View\Helper\Report\ReviewerLink"
      "projectReportWindowLink" => "Project\View\Helper\Report\WindowLink"
      "projectReportWindowProjectLink" => "Project\View\Helper\Report\Window\ProjectLink"
      "reportWorkpackageDescriptionLink" => "Project\View\Helper\Report\WorkpackageDescriptionLink"
      "workpackageLink" => "Project\View\Helper\Workpackage\WorkpackageLink"
      "workpackageDocumentLink" => "Project\View\Helper\Workpackage\DocumentLink"
      "workpackageTaskLink" => "Project\View\Helper\Workpackage\TaskLink"
      "workpackageDeliverableLink" => "Project\View\Helper\Workpackage\DeliverableLink"
      "workpackageDescriptionLink" => "Project\View\Helper\Workpackage\DescriptionLink"
      "workpackageDeliverableDocumentLink" => "Project\View\Helper\Workpackage\Deliverable\DocumentLink"
      "workpackageDeliverableTypeLink" => "Project\View\Helper\Workpackage\Deliverable\TypeLink"
      "posterLink" => "Project\View\Helper\PosterLink"
      "feeLink" => "Project\View\Helper\FeeLink"
      "ideaLink" => "Project\View\Helper\Idea\IdeaLink"
      "ideaToolLink" => "Project\View\Helper\Idea\ToolLink"
      "ideaInviteLink" => "Project\View\Helper\Idea\InviteLink"
      "ideaDescriptionLink" => "Project\View\Helper\Idea\DescriptionLink"
      "ideaPartnerLink" => "Project\View\Helper\Idea\PartnerLink"
      "ideaPosterLink" => "Project\View\Helper\Idea\PosterLink"
      "ideaPosterAttachment" => "Project\View\Helper\Idea\Poster\Attachment"
      "ideaPosterThumbnail" => "Project\View\Helper\Idea\Poster\Thumbnail"
      "ideaDocumentLink" => "Project\View\Helper\Idea\DocumentLink"
      "ideaImageLink" => "Project\View\Helper\Idea\ImageLink"
      "ideaVideoLink" => "Project\View\Helper\Idea\VideoLink"
      "ideaMeetingLink" => "Project\View\Helper\Idea\MeetingLink"
      "ideaMeetingInviteLink" => "Project\View\Helper\Idea\Meeting\InviteLink"
      "ideaMessageLink" => "Project\View\Helper\Idea\MessageLink"
      "ideaMessageDocumentLink" => "Project\View\Helper\Idea\Message\DocumentLink"
      "ideaStatusLink" => "Project\View\Helper\Idea\StatusLink"
      "ideaStatusDocumentLink" => "Project\View\Helper\Idea\Status\DocumentLink"
      "ideaDescriptionTypeLink" => "Project\View\Helper\Idea\Description\TypeLink"
      "buildHelp" => "Project\View\Helper\BuildHelp"
      "descriptionLink" => "Project\View\Helper\DescriptionLink"
      "buildDescription" => "Project\View\Helper\Description\BuildTree"
      "buildDescriptionNavigation" => "Project\View\Helper\Description\BuildNavigation"
      "buildDescriptionContent" => "Project\View\Helper\Description\BuildContent"
      "rationaleLink" => "Project\View\Helper\RationaleLink"
      "achievementLink" => "Project\View\Helper\Achievement\AchievementLink"
      "achievementTypeLink" => "Project\View\Helper\Achievement\TypeLink"
      "achievementCategoryLink" => "Project\View\Helper\Achievement\CategoryLink"
      "achievementExploitableResultLink" => "Project\View\Helper\Achievement\ExploitableResultLink"
      "achievementExploitableResultLinkLink" => "Project\View\Helper\Achievement\ExploitableResult\LinkLink"
      "achievementExploitableResultDocumentLink" => "Project\View\Helper\Achievement\ExploitableResult\DocumentLink"
      "changeRequestProcessLink" => "Project\View\Helper\ChangeRequest\ProcessLink"
      "changeRequestCostChangeLink" => "Project\View\Helper\ChangeRequest\CostChangeLink"
      "changeRequestCountryLink" => "Project\View\Helper\ChangeRequest\CountryLink"
      "projectCalendarReviewerLink" => "Project\View\Helper\Project\CalendarReviewerLink"
      "projectContractLink" => "Project\View\Helper\Contract\ContractLink"
      "contractDocumentLink" => "Project\View\Helper\Contract\DocumentLink"
      "contractVersionLink" => "Project\View\Helper\Contract\VersionLink"
      "contractVersionDocumentLink" => "Project\View\Helper\Contract\VersionDocumentLink"
      "actionLink" => "Project\View\Helper\Action\ActionLink"
      "actionTypeLink" => "Project\View\Helper\Action\TypeLink"
      "awardLink" => "Project\View\Helper\Award\AwardLink"
      "awardTypeLink" => "Project\View\Helper\Award\TypeLink"
      "eventLink" => "Project\View\Helper\EventLink"
      "eventTypeLink" => "Project\View\Helper\EventTypeLink"
      "projectformelement" => "Project\Form\View\Helper\ProjectFormElement"
      "resultselect" => "Project\Form\View\Helper\ResultSelect"
      "feedbackLink" => "Evaluation\View\Helper\FeedbackLink"
      "evaluationLink" => "Evaluation\View\Helper\EvaluationLink"
      "evaluationReportLink" => "Evaluation\View\Helper\ReportLink"
      "evaluationReportDownloadLink" => "Evaluation\View\Helper\Report\DownloadLink"
      "evaluationReportPresentationLink" => "Evaluation\View\Helper\Report\PresentationLink"
      "evaluationReportFinalLink" => "Evaluation\View\Helper\Report\FinalLink"
      "evaluationReportProgress" => "Evaluation\View\Helper\Report\Progress"
      "evaluationReportScore" => "Evaluation\View\Helper\Report\Score"
      "reportVersionLink" => "Evaluation\View\Helper\Report\VersionLink"
      "reportWindowLink" => "Evaluation\View\Helper\Report\WindowLink"
      "reportCriterionLink" => "Evaluation\View\Helper\Report\CriterionLink"
      "reportCriterionCategoryLink" => "Evaluation\View\Helper\Report\Criterion\CategoryLink"
      "reportCriterionTypeLink" => "Evaluation\View\Helper\Report\Criterion\TypeLink"
      "reportCriterionTopicLink" => "Evaluation\View\Helper\Report\Criterion\TopicLink"
      "reportCriterionVersionLink" => "Evaluation\View\Helper\Report\Criterion\VersionLink"
      "reviewerLink" => "Evaluation\View\Helper\ReviewerLink"
      "reviewerContactLink" => "Evaluation\View\Helper\Reviewer\ContactLink"
      "pressArticleLink" => "Press\View\Helper\ArticleLink"
      "bureauLink" => "Press\View\Helper\BureauLink"
      "programHandler" => "Program\View\Handler\ProgramHandler"
      "callInformationBox" => "Program\View\Helper\CallInformationBox"
      "programLink" => "Program\View\Helper\ProgramLink"
      "programDoaLink" => "Program\View\Helper\DoaLink"
      "callLink" => "Program\View\Helper\CallLink"
      "ndaLink" => "Program\View\Helper\NdaLink"
      "funderLink" => "Program\View\Helper\FunderLink"
      "callCountryLink" => "Program\View\Helper\CallCountryLink"
      "accessLink" => "Admin\View\Helper\AccessLink"
      "permitEntityLink" => "Admin\View\Helper\Permit\EntityLink"
      "permitRoleLink" => "Admin\View\Helper\Permit\RoleLink"
      "permitSetterLink" => "Admin\View\Helper\Permit\SetterLink"
      "queueLink" => "Admin\View\Helper\QueueLink"
      "oauth2clientlink" => "Admin\View\Helper\OAuth2\ClientLink"
      "oauth2scopelink" => "Admin\View\Helper\OAuth2\ScopeLink"
      "apiLogLink" => "Admin\View\Helper\Api\LogLink"
      "accessformelement" => "Admin\Form\View\Helper\AccessFormElement"
      "ztbalert" => "lbs5alert"
      "ztbformelement" => "lbs5formelement"
      "filterbarelement" => "lbs5filterbarelement"
      "lbs5navigation" => "LaminasBootstrap5\View\Helper\Navigation"
      "lbs5filterbarelement" => "LaminasBootstrap5\Form\View\Helper\FilterBarElement"
      "lbs5filtercolumnelement" => "LaminasBootstrap5\Form\View\Helper\FilterColumnElement"
      "lbs5formelement" => "LaminasBootstrap5\Form\View\Helper\FormElement"
      "lbs5formcheckbox" => "LaminasBootstrap5\Form\View\Helper\FormCheckbox"
      "associateLink" => "Affiliation\View\Helper\AssociateLink"
      "affiliationLink" => "Affiliation\View\Helper\AffiliationLink"
      "affiliationDoaLink" => "Affiliation\View\Helper\DoaLink"
      "affiliationLoiLink" => "Affiliation\View\Helper\LoiLink"
      "paymentSheet" => "Affiliation\View\Helper\PaymentSheet"
      "affiliationEffortSpentLink" => "Affiliation\View\Helper\EffortSpentLink"
      "affiliationQuestionCategoryLink" => "Affiliation\View\Helper\Questionnaire\CategoryLink"
      "affiliationQuestionLink" => "Affiliation\View\Helper\Questionnaire\QuestionLink"
      "affiliationQuestionnaireLink" => "Affiliation\View\Helper\Questionnaire\QuestionnaireLink"
      "questionnaireHelper" => "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper"
      "organisationLink" => "Organisation\View\Helper\OrganisationLink"
      "organisationTypeLink" => "Organisation\View\Helper\Organisation\TypeLink"
      "organisationLogo" => "Organisation\View\Helper\OrganisationLogo"
      "organisationNoteLink" => "Organisation\View\Helper\NoteLink"
      "boardLink" => "Organisation\View\Helper\BoardLink"
      "organisationSelectionLink" => "Organisation\View\Helper\SelectionLink"
      "parentLink" => "Organisation\View\Helper\Parent\ParentLink"
      "parentOrganisationLink" => "Organisation\View\Helper\Parent\OrganisationLink"
      "parentDoaLink" => "Organisation\View\Helper\Parent\DoaLink"
      "parentTypeLink" => "Organisation\View\Helper\Parent\TypeLink"
      "parentFinancialLink" => "Organisation\View\Helper\Parent\FinancialLink"
      "advisoryBoardCityLink" => "Organisation\View\Helper\AdvisoryBoard\CityLink"
      "advisoryBoardCityImage" => "Organisation\View\Helper\AdvisoryBoard\CityImage"
      "advisoryBoardSolutionLink" => "Organisation\View\Helper\AdvisoryBoard\SolutionLink"
      "advisoryBoardSolutionImage" => "Organisation\View\Helper\AdvisoryBoard\SolutionImage"
      "organisationUpdateLink" => "Organisation\View\Helper\UpdateLink"
      "organisationUpdateLogo" => "Organisation\View\Helper\UpdateLogo"
      "organisationUpdateNotification" => "Organisation\View\Helper\UpdateNotification"
      "overviewVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution"
      "overviewExtraVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution"
      "organisationselect" => "Organisation\Form\View\Helper\OrganisationFormElement"
      "parentformelement" => "Organisation\Form\View\Helper\ParentFormElement"
      "publicationLink" => "Publication\View\Helper\PublicationLink"
      "publicationTypeLink" => "Publication\View\Helper\TypeLink"
      "publicationCategoryLink" => "Publication\View\Helper\CategoryLink"
      "invoiceLink" => "Invoice\View\Helper\InvoiceLink"
      "transactionLink" => "Invoice\View\Helper\TransactionLink"
      "invoiceRowLink" => "Invoice\View\Helper\RowLink"
      "dimensionLink" => "Invoice\View\Helper\DimensionLink"
      "invoicePdfLink" => "Invoice\View\Helper\PdfLink"
      "invoiceWordLink" => "Invoice\View\Helper\WordLink"
      "reminderLink" => "Invoice\View\Helper\ReminderLink"
      "reminderInvoiceOverview" => "Invoice\View\Helper\ReminderInvoiceOverview"
      "journalLink" => "Invoice\View\Helper\JournalLink"
      "dailyUpdateHandler" => "Invoice\View\Helper\DailyUpdateHandler"
      "canAssemble" => "Deeplink\View\Helper\CanAssemble"
      "deeplinkLink" => "Deeplink\View\Helper\DeeplinkLink"
      "deeplinkTargetLink" => "Deeplink\View\Helper\Deeplink\TargetLink"
      "deskCostsLink" => "Event\View\Helper\DeskCostsLink"
      "meetingLink" => "Event\View\Helper\Meeting\MeetingLink"
      "meetingOptionLink" => "Event\View\Helper\Meeting\OptionLink"
      "meetingOptionCostLink" => "Event\View\Helper\Meeting\OptionCostLink"
      "meetingCostLink" => "Event\View\Helper\Meeting\CostLink"
      "meetingQuotaLink" => "Event\View\Helper\Meeting\QuotaLink"
      "meetingCouponLink" => "Event\View\Helper\CouponLink"
      "boothLink" => "Event\View\Helper\Booth\BoothLink"
      "boothSpecLink" => "Event\View\Helper\Booth\SpecLink"
      "exhibitionLink" => "Event\View\Helper\Exhibition\ExhibitionLink"
      "registrationLink" => "Event\View\Helper\RegistrationLink"
      "meetingFloorplanLink" => "Event\View\Helper\Meeting\FloorplanLink"
      "exhibitionSpecLink" => "Event\View\Helper\Exhibition\SpecLink"
      "exhibitionCostLink" => "Event\View\Helper\Exhibition\CostLink"
      "badgeLink" => "Event\View\Helper\Badge\BadgeLink"
      "badgeAttachmentLink" => "Event\View\Helper\Badge\AttachmentLink"
      "badgeImage" => "Event\View\Helper\Badge\Image"
      "badgeContactLink" => "Event\View\Helper\Badge\ContactLink"
      "ticketImage" => "Event\View\Helper\Ticket\Image"
      "ticketLink" => "Event\View\Helper\Ticket\TicketLink"
      "calendarDocumentLink" => "Calendar\View\Helper\DocumentLink"
      "calendarTypeLink" => "Calendar\View\Helper\TypeLink"
      "calendarLink" => "Calendar\View\Helper\CalendarLink"
      "mailingLink" => "Mailing\View\Helper\MailingLink"
      "attachmentLink" => "Mailing\View\Helper\AttachmentLink"
      "mailingContactLink" => "Mailing\View\Helper\MailingContactLink"
      "mailingTemplateLink" => "Mailing\View\Helper\TemplateLink"
      "senderLink" => "Mailing\View\Helper\SenderLink"
      "emailMessageEventIcon" => "Mailing\View\Helper\EmailMessageEventIcon"
    ]
    "factories" => array:348 [
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\ApiTools\Documentation\View\AgAcceptHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgServicePath" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgStatusCodes" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgTransformDescription" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Hal" => "Laminas\ApiTools\Hal\Factory\HalViewHelperFactory"
      "AssetManager\View\Helper\Asset" => "AssetManager\Service\AssetViewHelperFactory"
      "isAllowed" => "BjyAuthorize\View\Helper\IsAllowedFactory"
      "Content\View\Helper\NodeLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ParamLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\HandlerLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\SegmentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TemplateLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ContentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\RouteLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TopicLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Image" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Video" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\NodeTableRow" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ImageHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ArticleHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ContentHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\PaginationLink" => "Application\Factory\InvokableFactory"
      "Content\View\Helper\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\ChallengeIcon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\ChallengeImage" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Image" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Icon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Country\CountryFlag" => "General\View\Factory\ImageHelperFactory"
      "General\View\Handler\CountryHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ImpactStreamHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ChallengeHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Challenge\ChallengeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\CurrencyLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ExchangeRateLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\PasswordLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LanguageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\GenderLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\EmailMessageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\TitleLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\WebInfoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ContentTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryMap" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\ContentTypeIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\View\Helper\ClusterLink" => "General\View\Factory\LinkHelperFactory"
      "Cluster\View\Helper\Cluster\Logo" => "General\View\Factory\ImageHelperFactory"
      "News\View\Handler\NewsHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\BlogHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\MagazineHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Helper\BlogLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\TagLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\NewsLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\News\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\MagazineLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Magazine\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\DndLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ProfileLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Selection\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\FacebookLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\OptInLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\AddressLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\NoteLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\PhoneLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactPhoto" => "General\View\Factory\ImageHelperFactory"
      "Contact\View\Helper\Office\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Office\LeaveLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\Form\View\Helper\ContactFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\View\Helper\SelectionFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusBadge" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Quality\View\Helper\PhaseLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\YearLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\KpiLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\Action\SourceLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\View\Helper\ProjectFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ProjectHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ResultHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\IdeaHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectLogo" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Project\Quickstart" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\StatusIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectDates" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaImage" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PcaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpFaqLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\VersionLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Version\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportHelper" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Report\ItemLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\Window\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WorkpackageDescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\WorkpackageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\TaskLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DeliverableLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\FeeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ToolLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PartnerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Description\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MeetingLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Meeting\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Message\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Status\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Poster\Attachment" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Poster\Thumbnail" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Tool\SessionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\BuildHelp" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Description\BuildTree" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildContent" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\RationaleLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\AchievementLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\LinkLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CostChangeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\CalendarReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\ContractLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionDocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\AwardLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventTypeLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\FeedbackLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\EvaluationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\DownloadLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\PresentationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\FinalLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Progress" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\Score" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\CriterionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Criterion\CategoryLink" => "General\View\Factory\LinkHelperFactory"
       …109
    ]
    "invokables" => array:18 [ …18]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:2 [ …2]
  ]
  "controller_plugins" => array:3 [
    "aliases" => array:100 [ …100]
    "factories" => array:89 [ …89]
    "invokables" => array:2 [ …2]
  ]
  "asset_manager" => array:6 [
    "resolver_configs" => array:4 [ …4]
    "clear_output_buffer" => true
    "resolvers" => array:6 [ …6]
    "view_helper" => array:3 [ …3]
    "caching" => array:4 [ …4]
    "filters" => array:2 [ …2]
  ]
  "api-tools" => array:1 [
    "db-connected" => []
  ]
  "controllers" => array:4 [
    "aliases" => array:3 [ …3]
    "factories" => array:330 [ …330]
    "abstract_factories" => array:2 [ …2]
    "invokables" => array:3 [ …3]
  ]
  "api-tools-content-negotiation" => array:6 [
    "controllers" => array:2 [ …2]
    "accept_whitelist" => array:1 [ …1]
    "selectors" => array:3 [ …3]
    "content_type_whitelist" => []
    "x_http_method_override_enabled" => false
    "http_override_methods" => []
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:5 [ …5]
    "display_exceptions" => true
    "template_map" => array:1497 [ …1497]
    "strategies" => array:2 [ …2]
    "display_not_found_reason" => true
    "doctype" => "HTML5"
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
  ]
  "api-tools-api-problem" => []
  "api-tools-configuration" => array:1 [
    "config_file" => "config/autoload/development.php"
  ]
  "api-tools-oauth2" => array:7 [
    "grant_types" => array:5 [ …5]
    "api_problem_error_response" => true
    "storage" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
    "options" => array:6 [ …6]
    "allow_implicit" => true
    "access_lifetime" => 3600
    "enforce_state" => true
  ]
  "api-tools-mvc-auth" => array:2 [
    "authentication" => array:2 [ …2]
    "authorization" => array:2 [ …2]
  ]
  "api-tools-hal" => array:3 [
    "renderer" => []
    "metadata_map" => []
    "options" => array:1 [ …1]
  ]
  "filters" => array:1 [
    "factories" => array:2 [ …2]
  ]
  "validators" => array:2 [
    "factories" => array:8 [ …8]
    "aliases" => array:3 [ …3]
  ]
  "input_filter_specs" => []
  "api-tools-content-validation" => array:1 [
    "methods_without_bodies" => []
  ]
  "api-tools-rest" => array:1 [
    "Api\V1\Rest\ContactResource\MeListener" => array:11 [ …11]
  ]
  "api-tools-rpc" => []
  "api-tools-versioning" => array:3 [
    "content-type" => []
    "default_version" => 1
    "uri" => []
  ]
  "bjyauthorize" => array:12 [
    "guards" => array:1 [ …1]
    "default_role" => "guest"
    "authenticated_role" => "user"
    "identity_provider" => "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider"
    "role_providers" => array:1 [ …1]
    "resource_providers" => []
    "rule_providers" => []
    "unauthorized_strategy" => "Jield\Authorize\View\UnauthorizedStrategy"
    "template" => "error/403"
    "cache_enabled" => true
    "cache_options" => array:2 [ …2]
    "cache_key" => "bjyauthorize_acl"
  ]
  "doctrine" => array:15 [
    "driver" => array:22 [ …22]
    "cache" => array:11 [ …11]
    "authentication" => array:2 [ …2]
    "authenticationadapter" => array:2 [ …2]
    "authenticationstorage" => array:2 [ …2]
    "authenticationservice" => array:2 [ …2]
    "connection" => array:1 [ …1]
    "configuration" => array:1 [ …1]
    "entitymanager" => array:1 [ …1]
    "eventmanager" => array:1 [ …1]
    "sql_logger_collector" => array:1 [ …1]
    "mapping_collector" => array:1 [ …1]
    "entity_resolver" => array:1 [ …1]
    "migrations_configuration" => array:1 [ …1]
    "migrations_cmd" => array:13 [ …13]
  ]
  "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory" => array:608 [
    "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
    "Jield\Authorize\View\UnauthorizedStrategy" => array:2 [ …2]
    "Application\Twig\DatabaseTwigLoader" => array:1 [ …1]
    "Application\Event\SetTitle" => array:2 [ …2]
    "Application\Event\InjectAclInNavigation" => array:2 [ …2]
    "Application\Event\BlockInactiveContact" => array:1 [ …1]
    "Application\Event\RegisterPageview" => array:3 [ …3]
    "Application\Authentication\Storage\AuthenticationStorage" => array:2 [ …2]
    "Laminas\Authentication\AuthenticationService" => array:1 [ …1]
    "Application\Session\SaveHandler\DoctrineGateway" => array:2 [ …2]
    "Content\Controller\Json\ArticleController" => array:1 [ …1]
    "Content\Controller\Json\ImageController" => array:3 [ …3]
    "Content\Controller\Json\NodeController" => array:3 [ …3]
    "Content\Controller\ArticleController" => array:4 [ …4]
    "Content\Controller\ContentController" => array:1 [ …1]
    "Content\Controller\ImageController" => array:4 [ …4]
    "Content\Controller\VideoController" => array:4 [ …4]
    "Content\Controller\NodeController" => array:3 [ …3]
    "Content\Controller\NodeManagerController" => array:4 [ …4]
    "Content\Controller\RedirectController" => array:3 [ …3]
    "Content\Navigation\Service\ContentNavigationService" => array:7 [ …7]
    "Content\InputFilter\HandlerFilter" => array:1 [ …1]
    "Content\InputFilter\RouteFilter" => array:1 [ …1]
    "Content\InputFilter\SegmentFilter" => array:1 [ …1]
    "Content\InputFilter\TemplateFilter" => array:1 [ …1]
    "Content\InputFilter\TopicFilter" => array:1 [ …1]
    "Content\Service\ArticleService" => array:1 [ …1]
    "Content\Service\VimeoService" => array:2 [ …2]
    "Content\Service\RouteService" => array:1 [ …1]
    "Content\Service\ContentService" => array:1 [ …1]
    "Content\Service\NodeService" => array:2 [ …2]
    "Content\View\Helper\BuildNavigation" => array:3 [ …3]
    "Content\View\Helper\NodeTableRow" => array:2 [ …2]
    "Content\View\Helper\Image" => array:3 [ …3]
    "Content\View\Handler\ArticleHandler" => array:8 [ …8]
    "Content\View\Handler\ContentHandler" => array:8 [ …8]
    "Content\View\Handler\ImageHandler" => array:8 [ …8]
    "General\Controller\ChallengeController" => array:4 [ …4]
    "General\Controller\ChallengeTypeController" => array:3 [ …3]
    "General\Controller\ContentTypeController" => array:3 [ …3]
    "General\Controller\LanguageController" => array:3 [ …3]
    "General\Controller\CountryController" => array:4 [ …4]
    "General\Controller\Country\VideoController" => array:3 [ …3]
    "General\Controller\CurrencyController" => array:3 [ …3]
    "General\Controller\EmailController" => array:2 [ …2]
    "General\Controller\ExchangeRateController" => array:3 [ …3]
    "General\Controller\GenderController" => array:3 [ …3]
    "General\Controller\ImageController" => array:2 [ …2]
    "General\Controller\ImpactStreamController" => array:3 [ …3]
    "General\Controller\LogController" => array:3 [ …3]
    "General\Controller\PasswordController" => array:3 [ …3]
    "General\Controller\TitleController" => array:3 [ …3]
    "General\Controller\VatController" => array:3 [ …3]
    "General\Controller\VatTypeController" => array:3 [ …3]
    "General\Controller\WebInfoController" => array:4 [ …4]
    "General\Service\GeneralService" => array:1 [ …1]
    "General\Service\CountryService" => array:3 [ …3]
    "General\View\Handler\ImpactStreamHandler" => array:9 [ …9]
    "General\View\Handler\ChallengeHandler" => array:7 [ …7]
    "General\View\Handler\CountryHandler" => array:9 [ …9]
    "General\View\Helper\ContentTypeIcon" => array:1 [ …1]
    "General\View\Helper\Country\CountryMap" => array:2 [ …2]
    "General\Search\Service\CountrySearchService" => array:1 [ …1]
    "Cluster\Command\UpdateProject" => array:4 [ …4]
    "Cluster\Command\GenerateProjectJson" => array:2 [ …2]
    "Cluster\Controller\Admin\ClusterController" => array:4 [ …4]
    "Cluster\Controller\ImageController" => array:1 [ …1]
    "Cluster\Service\ClusterService" => array:1 [ …1]
    "Cluster\Service\StatisticsService" => array:1 [ …1]
    "Cluster\Form\ClusterForm" => array:1 [ …1]
    "News\Controller\BlogController" => array:4 [ …4]
    "News\Controller\Blog\CategoryController" => array:3 [ …3]
    "News\Controller\Blog\TagController" => array:3 [ …3]
    "News\Controller\Blog\MessageController" => array:3 [ …3]
    "News\Controller\NewsController" => array:4 [ …4]
    "News\Controller\News\CategoryController" => array:3 [ …3]
    "News\Controller\MagazineController" => array:4 [ …4]
    "News\Controller\Magazine\ArticleController" => array:4 [ …4]
    "News\Service\BlogService" => array:4 [ …4]
    "News\Service\NewsService" => array:3 [ …3]
    "News\Service\MagazineService" => array:1 [ …1]
    "News\Search\Service\NewsSearchService" => array:1 [ …1]
    "News\Search\Service\BlogSearchService" => array:1 [ …1]
    "News\View\Handler\NewsHandler" => array:7 [ …7]
    "News\View\Handler\BlogHandler" => array:7 [ …7]
    "News\View\Handler\MagazineHandler" => array:6 [ …6]
    "Contact\Controller\AddressManagerController" => array:3 [ …3]
    "Contact\Controller\ContactAdminController" => array:12 [ …12]
    "Contact\Controller\ContactDetailsController" => array:10 [ …10]
    "Contact\Controller\ContactController" => array:3 [ …3]
    "Contact\Controller\DndController" => array:5 [ …5]
    "Contact\Controller\FacebookController" => array:3 [ …3]
    "Contact\Controller\FacebookManagerController" => array:3 [ …3]
    "Contact\Controller\OptInManagerController" => array:3 [ …3]
    "Contact\Controller\ImageController" => array:1 [ …1]
    "Contact\Controller\NoteManagerController" => array:3 [ …3]
    "Contact\Controller\PhoneManagerController" => array:3 [ …3]
    "Contact\Controller\ProfileController" => array:10 [ …10]
    "Contact\Controller\Selection\ManagerController" => array:7 [ …7]
    "Contact\Controller\Selection\TypeController" => array:3 [ …3]
    "Contact\Controller\Office\ContactController" => array:2 [ …2]
    "Contact\Controller\Office\LeaveController" => array:3 [ …3]
    "Contact\Command\Cleanup" => array:1 [ …1]
    "Contact\Command\ResetAccess" => array:1 [ …1]
    "Contact\Provider\ContactProvider" => array:1 [ …1]
    "Contact\Controller\Plugin\MergeContact" => array:3 [ …3]
    "Contact\Controller\Plugin\ContactActions" => array:3 [ …3]
    "Contact\Controller\Plugin\HandleImport" => array:6 [ …6]
    "Contact\Controller\Plugin\SelectionExport" => array:4 [ …4]
    "Contact\Search\Service\ContactSearchService" => array:1 [ …1]
    "Contact\Search\Service\ProfileSearchService" => array:1 [ …1]
    "Contact\Form\ContactForm" => array:1 [ …1]
    "Contact\Form\View\Helper\ContactFormElement" => array:3 [ …3]
    "Contact\Form\View\Helper\SelectionFormElement" => array:2 [ …2]
    "Contact\Service\AddressService" => array:1 [ …1]
    "Contact\Service\ContactService" => array:9 [ …9]
    "Contact\Service\SelectionContactService" => array:1 [ …1]
    "Contact\Service\SelectionService" => array:3 [ …3]
    "Contact\Service\Office\ContactService" => array:1 [ …1]
    "Quality\Controller\IndexController" => array:1 [ …1]
    "Quality\Controller\ProcessController" => array:2 [ …2]
    "Quality\Controller\PhaseController" => array:2 [ …2]
    "Quality\Controller\StatusController" => array:2 [ …2]
    "Quality\Controller\YearController" => array:2 [ …2]
    "Quality\Controller\ActionController" => array:2 [ …2]
    "Quality\Controller\TargetController" => array:2 [ …2]
    "Quality\Controller\KpiController" => array:2 [ …2]
    "Quality\Controller\Kpi\TargetController" => array:2 [ …2]
    "Quality\Controller\Kpi\GroupController" => array:2 [ …2]
    "Quality\Controller\Kpi\ResultController" => array:2 [ …2]
    "Quality\Controller\Kpi\Result\MatrixController" => array:1 [ …1]
    "Quality\Controller\Kpi\ActionController" => array:1 [ …1]
    "Quality\Controller\Action\SourceController" => array:2 [ …2]
    "Quality\Controller\Action\GroupController" => array:2 [ …2]
    "Quality\Controller\Action\ResultController" => array:2 [ …2]
    "Quality\Controller\Action\Result\MatrixController" => array:2 [ …2]
    "Quality\Service\QualityService" => array:2 [ …2]
    "Quality\View\Helper\Kpi\Result\Matrix" => array:2 [ …2]
    "Quality\View\Helper\Action\Result\Matrix" => array:2 [ …2]
    "Project\Controller\Json\AchievementController" => array:1 [ …1]
    "Project\Controller\Json\Achievement\ExploitableResultController" => array:1 [ …1]
    "Project\Controller\Json\ContractController" => array:3 [ …3]
    "Project\Controller\Json\CostController" => array:5 [ …5]
    "Project\Controller\Json\DescriptionController" => array:1 [ …1]
    "Project\Controller\Json\EffortController" => array:6 [ …6]
    "Project\Controller\Json\FundingController" => array:3 [ …3]
    "Project\Controller\Json\FundingStatusController" => array:2 [ …2]
    "Project\Controller\Json\HelpController" => array:1 [ …1]
    "Project\Controller\Json\IdeaController" => array:1 [ …1]
    "Project\Controller\Json\Idea\ToolController" => array:2 [ …2]
    "Project\Controller\Json\Idea\PosterController" => array:2 [ …2]
    "Project\Controller\Json\InviteController" => array:6 [ …6]
    "Project\Controller\Json\ReportController" => array:1 [ …1]
    "Project\Controller\Json\ResultController" => array:1 [ …1]
    "Project\Controller\Json\WorkpackageController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\TaskController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\DeliverableController" => array:3 [ …3]
    "Project\Controller\Action\TypeController" => array:3 [ …3]
    "Project\Controller\Action\ActionController" => array:10 [ …10]
    "Project\Controller\Event\TypeController" => array:3 [ …3]
    "Project\Controller\SelectionController" => array:4 [ …4]
    "Project\Controller\Event\EventController" => array:5 [ …5]
    "Project\Controller\ChangeRequest\ChangeRequestController" => array:7 [ …7]
    "Project\Controller\ChangeRequest\ProcessController" => array:9 [ …9]
    "Project\Controller\ChangeRequest\UpdateController" => array:14 [ …14]
    "Project\Controller\ChangeRequest\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\Admin\DetailsController" => array:3 [ …3]
    "Project\Controller\Idea\PosterManagerController" => array:5 [ …5]
    "Project\Controller\Idea\PosterController" => array:1 [ …1]
    "Project\Controller\Achievement\AchievementController" => array:6 [ …6]
    "Project\Controller\Achievement\ExploitableResultController" => array:6 [ …6]
    "Project\Controller\Achievement\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\TypeController" => array:2 [ …2]
    "Project\Controller\Achievement\CategoryController" => array:4 [ …4]
    "Project\Controller\Achievement\ExploitableResult\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\ExploitableResult\LinkController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Link\ManagerController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\DocumentController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Document\ManagerController" => array:3 [ …3]
    "Project\Controller\Award\AwardController" => array:3 [ …3]
    "Project\Controller\Award\TypeController" => array:2 [ …2]
    "Project\Controller\Contract\ContractController" => array:6 [ …6]
    "Project\Controller\Contract\DocumentController" => array:1 [ …1]
    "Project\Controller\Contract\VersionController" => array:3 [ …3]
    "Project\Controller\CommunityController" => array:21 [ …21]
    "Project\Controller\Rationale\RationaleController" => array:10 [ …10]
    "Project\Controller\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\DocumentController" => array:5 [ …5]
    "Project\Controller\Document\TypeController" => array:2 [ …2]
    "Project\Controller\EditController" => array:14 [ …14]
    "Project\Controller\FeeManagerController" => array:2 [ …2]
    "Project\Controller\HelpController" => array:3 [ …3]
    "Project\Controller\EventManagerController" => array:4 [ …4]
    "Project\Controller\HelpManagerController" => array:3 [ …3]
    "Project\Controller\ImageController" => array:1 [ …1]
    "Project\Controller\Idea\IdeaController" => array:13 [ …13]
    "Project\Controller\Idea\InviteController" => array:3 [ …3]
    "Project\Controller\Idea\DescriptionController" => array:2 [ …2]
    "Project\Controller\Idea\Description\TypeController" => array:2 [ …2]
    "Project\Controller\Idea\ToolController" => array:1 [ …1]
    "Project\Controller\Idea\ToolManagerController" => array:4 [ …4]
    "Project\Controller\Idea\Tool\Session\ManagerController" => array:5 [ …5]
    "Project\Controller\Idea\Tool\SessionController" => array:2 [ …2]
    "Project\Controller\Idea\PartnerController" => array:3 [ …3]
    "Project\Controller\Idea\DocumentController" => array:2 [ …2]
    "Project\Controller\Idea\ImageController" => array:2 [ …2]
    "Project\Controller\Idea\VideoController" => array:3 [ …3]
    "Project\Controller\Idea\MeetingController" => array:4 [ …4]
    "Project\Controller\Idea\MeetingManagerController" => array:3 [ …3]
    "Project\Controller\Idea\Meeting\InviteController" => array:5 [ …5]
    "Project\Controller\Idea\MessageController" => array:3 [ …3]
    "Project\Controller\Idea\Message\DocumentController" => array:1 [ …1]
    "Project\Controller\Idea\StatusController" => array:3 [ …3]
    "Project\Controller\Idea\Status\DocumentController" => array:1 [ …1]
    "Project\Controller\InviteController" => array:6 [ …6]
    "Project\Controller\PcaController" => array:3 [ …3]
    "Project\Controller\PcaManagerController" => array:5 [ …5]
    "Project\Controller\LogManagerController" => array:5 [ …5]
    "Project\Controller\Project\AdminController" => array:23 [ …23]
    "Project\Controller\Project\CalendarManagerController" => array:3 [ …3]
    "Project\Controller\Project\ProjectController" => array:2 [ …2]
    "Project\Controller\Project\DetailsController" => array:24 [ …24]
    "Project\Controller\Project\ExportController" => array:1 [ …1]
    "Project\Controller\Project\ManagerController" => array:8 [ …8]
    "Project\Controller\Rationale\ManagerController" => array:4 [ …4]
    "Project\Controller\Report\ReportController" => array:6 [ …6]
    "Project\Controller\Report\DetailsController" => array:11 [ …11]
    "Project\Controller\Report\ItemController" => array:3 [ …3]
    "Project\Controller\Report\ManagerController" => array:10 [ …10]
    "Project\Controller\Report\WindowController" => array:3 [ …3]
    "Project\Controller\Report\Window\ProjectController" => array:2 [ …2]
    "Project\Controller\Result\CategoryController" => array:2 [ …2]
    "Project\Controller\Result\ManagerController" => array:6 [ …6]
    "Project\Controller\Result\TypeController" => array:2 [ …2]
    "Project\Controller\RoadmapController" => array:5 [ …5]
    "Project\Controller\Version\VersionController" => array:11 [ …11]
    "Project\Controller\Version\DocumentController" => array:5 [ …5]
    "Project\Controller\Version\Document\ManagerController" => array:6 [ …6]
    "Project\Controller\Version\ManagerController" => array:15 [ …15]
    "Project\Controller\Version\TypeController" => array:3 [ …3]
    "Project\Controller\Workpackage\WorkpackageController" => array:7 [ …7]
    "Project\Controller\Workpackage\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\DocumentManagerController" => array:5 [ …5]
    "Project\Controller\Workpackage\Deliverable\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\Deliverable\DocumentManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\ManagerController" => array:6 [ …6]
    "Project\Controller\Workpackage\Deliverable\TypeController" => array:3 [ …3]
    "Project\Controller\StatisticsController" => array:1 [ …1]
    "Project\Provider\ProjectProvider" => array:6 [ …6]
    "Project\Provider\Version\VersionProvider" => array:3 [ …3]
    "Project\Job\CometChat\CreateIdeaGroup" => array:4 [ …4]
    "Project\Job\CometChat\UpdateMembersOfIdeaGroup" => array:4 [ …4]
    "Project\Controller\Plugin\CreateExport" => array:4 [ …4]
    "Project\Controller\Plugin\SelectionExport" => array:5 [ …5]
    "Project\Controller\Plugin\Merge\CreateMergedDocument" => array:12 [ …12]
    "Project\Controller\Plugin\Merge\CreateSummaryDocument" => array:4 [ …4]
    "Project\Controller\Plugin\Merge\CreateMergedProjectReport" => array:13 [ …13]
    "Project\Controller\Plugin\Merge\CreateMergedChangeRequestDocument" => array:7 [ …7]
    "Project\Controller\Plugin\CreateVersion" => array:7 [ …7]
    "Project\Controller\Plugin\Checklist\ProjectChecklist" => array:8 [ …8]
    "Project\Controller\Plugin\Checklist\ReportChecklist" => array:5 [ …5]
    "Project\Controller\Plugin\Changes\ProjectChanges" => array:5 [ …5]
    "Project\Controller\Plugin\Checklist\ChangeRequestChecklist" => array:7 [ …7]
    "Project\Controller\Plugin\RenderReportWorkpackageDescriptions" => array:2 [ …2]
    "Project\Controller\Plugin\RenderVersionStatistics" => array:7 [ …7]
    "Project\Controller\Plugin\Achievement\Export" => array:2 [ …2]
    "Project\Controller\Plugin\Achievement\Import" => array:2 [ …2]
    "Project\Controller\Plugin\ActionExport" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\IdeasPerCountryDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Invite\Accept" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Accept" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Export" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionPdf" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionSpreadsheet" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Poster\PosterPdf" => array:3 [ …3]
    "Project\InputFilter\RationaleFilter" => array:1 [ …1]
    "Project\Form\ProjectForm" => array:1 [ …1]
    "Project\Service\ProjectService" => array:9 [ …9]
    "Project\Service\ActionService" => array:5 [ …5]
    "Project\Service\VersionService" => array:3 [ …3]
    "Project\Service\WorkpackageService" => array:4 [ …4]
    "Project\Service\IdeaService" => array:12 [ …12]
    "Project\Service\Idea\MeetingService" => array:2 [ …2]
    "Project\Service\Idea\Tool\SessionService" => array:2 [ …2]
    "Project\Service\DescriptionService" => array:3 [ …3]
    "Project\Service\ResultService" => array:4 [ …4]
    "Project\Service\VersionDocumentService" => array:4 [ …4]
    "Project\Service\EventService" => array:2 [ …2]
    "Project\Service\HelpService" => array:2 [ …2]
    "Project\Service\KeywordService" => array:1 [ …1]
    "Project\Service\AchievementService" => array:4 [ …4]
    "Project\Service\Achievement\ExploitableResultService" => array:4 [ …4]
    "Project\Service\ReportService" => array:2 [ …2]
    "Project\Service\DocumentService" => array:1 [ …1]
    "Project\Service\ContractService" => array:2 [ …2]
    "Project\Service\InviteService" => array:6 [ …6]
    "Project\Service\SelectionService" => array:1 [ …1]
    "Project\Service\AwardService" => array:1 [ …1]
    "Project\Service\ChangeRequestService" => array:7 [ …7]
    "Project\Service\Report\WindowService" => array:1 [ …1]
    "Project\Search\Service\AchievementSearchService" => array:1 [ …1]
    "Project\Search\Service\Achievement\ExploitableResultSearchService" => array:1 [ …1]
    "Project\Search\Service\IdeaSearchService" => array:1 [ …1]
    "Project\Search\Service\DescriptionSearchService" => array:1 [ …1]
    "Project\Search\Service\ProjectSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\WorkpackageDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\ResultSearchService" => array:1 [ …1]
    "Project\Search\Service\ActionSearchService" => array:1 [ …1]
    "Project\View\Handler\ProjectHandler" => array:16 [ …16]
    "Project\View\Handler\ResultHandler" => array:8 [ …8]
    "Project\View\Handler\IdeaHandler" => array:11 [ …11]
    "Project\View\Helper\Project\StatusIcon" => array:1 [ …1]
    "Project\View\Helper\Project\ProjectDates" => array:3 [ …3]
    "Project\View\Helper\Description\BuildContent" => array:1 [ …1]
    "Project\View\Helper\Description\BuildNavigation" => array:2 [ …2]
    "Project\View\Helper\Description\BuildTree" => array:2 [ …2]
    "Project\View\Helper\Project\Quickstart" => array:2 [ …2]
    "Project\View\Helper\BuildHelp" => array:3 [ …3]
    "Project\View\Helper\Version\VersionLink" => array:6 [ …6]
    "Project\View\Helper\HelpLink" => array:6 [ …6]
    "Project\View\Helper\Report\ReportHelper" => array:1 [ …1]
    "Project\Form\View\Helper\ProjectFormElement" => array:2 [ …2]
    "Evaluation\Controller\ReportController" => array:4 [ …4]
    "Evaluation\Controller\FeedbackController" => array:4 [ …4]
    "Evaluation\Controller\EvaluationController" => array:10 [ …10]
    "Evaluation\Controller\EvaluationManagerController" => array:4 [ …4]
    "Evaluation\Controller\ReportManagerController" => array:5 [ …5]
    "Evaluation\Controller\Report\CriterionController" => array:4 [ …4]
    "Evaluation\Controller\Report\VersionController" => array:4 [ …4]
    "Evaluation\Controller\Report\WindowController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\CategoryController" => array:2 [ …2]
    "Evaluation\Controller\Report\Criterion\TypeController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\TopicController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\VersionController" => array:3 [ …3]
    "Evaluation\Controller\ReviewerManagerController" => array:5 [ …5]
    "Evaluation\Controller\ReviewScheduleController" => array:5 [ …5]
    "Evaluation\Controller\Reviewer\ContactManagerController" => array:2 [ …2]
    "Evaluation\Controller\JsonController" => array:3 [ …3]
    "Evaluation\Controller\Plugin\CreateEvaluation" => array:5 [ …5]
    "Evaluation\Controller\Plugin\RosterGenerator" => array:3 [ …3]
    "Evaluation\Controller\Plugin\Report\ExcelExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ExcelDownload" => array:2 [ …2]
    "Evaluation\Controller\Plugin\Report\ExcelImport" => array:1 [ …1]
    "Evaluation\Controller\Plugin\Report\PdfExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ConsolidatedPdfExport" => array:10 [ …10]
    "Evaluation\Controller\Plugin\Report\Presentation" => array:2 [ …2]
    "Evaluation\Controller\Plugin\RenderProjectEvaluation" => array:3 [ …3]
    "Evaluation\Service\EvaluationService" => array:1 [ …1]
    "Evaluation\Service\EvaluationReportService" => array:2 [ …2]
    "Evaluation\Service\ReviewerService" => array:1 [ …1]
    "Evaluation\Service\ReviewRosterService" => array:5 [ …5]
    "Evaluation\View\Helper\Report\Progress" => array:2 [ …2]
    "Evaluation\View\Helper\Report\Score" => array:1 [ …1]
    "Press\Controller\ArticleController" => array:5 [ …5]
    "Press\Controller\BureauController" => array:3 [ …3]
    "Press\Controller\PressController" => array:1 [ …1]
    "Press\Service\PressService" => array:2 [ …2]
    "Press\Search\Service\PressSearchService" => array:1 [ …1]
    "Press\View\Handler\PressHandler" => array:7 [ …7]
    "Program\Controller\Plugin\CreateCallFundingOverview" => array:5 [ …5]
    "Program\Controller\Plugin\CreateFundingDownload" => array:3 [ …3]
    "Program\Controller\Plugin\RenderDoa" => array:3 [ …3]
    "Program\Controller\Plugin\RenderNda" => array:3 [ …3]
    "Program\Controller\Plugin\CallSizeSpreadsheet" => array:8 [ …8]
    "Program\Controller\CallController" => array:6 [ …6]
    "Program\Controller\CallCountryManagerController" => array:4 [ …4]
    "Program\Controller\CallManagerController" => array:9 [ …9]
    "Program\Controller\DoaController" => array:4 [ …4]
    "Program\Controller\FunderManagerController" => array:3 [ …3]
    "Program\Controller\NdaController" => array:6 [ …6]
    "Program\Controller\NdaManagerController" => array:8 [ …8]
    "Program\Controller\ProgramManagerController" => array:3 [ …3]
    "Program\Service\ProgramService" => array:5 [ …5]
    "Program\Service\CallService" => array:3 [ …3]
    "Program\View\Handler\ProgramHandler" => array:6 [ …6]
    "Program\View\Helper\CallInformationBox" => array:3 [ …3]
    "Search\Controller\IndexController" => array:1 [ …1]
    "Search\Command\UpdateIndex" => array:1 [ …1]
    "Search\Service\ConsoleService" => array:22 [ …22]
    "Admin\Controller\AccessController" => array:5 [ …5]
    "Admin\Controller\AdminController" => array:9 [ …9]
    "Admin\Controller\QueueController" => array:2 [ …2]
    "Admin\Controller\Api\LogController" => array:1 [ …1]
    "Admin\Controller\UserController" => array:5 [ …5]
    "Admin\Controller\OAuth2Controller" => array:3 [ …3]
    "Admin\Controller\OAuth2\ClientController" => array:3 [ …3]
    "Admin\Controller\OAuth2\ScopeController" => array:2 [ …2]
    "Admin\Controller\StatisticsController" => array:3 [ …3]
    "Admin\Controller\CacheController" => array:1 [ …1]
    "Admin\Controller\FixController" => []
    "Admin\Controller\PermitController" => array:3 [ …3]
    "Admin\InputFilter\AccessFilter" => array:1 [ …1]
    "Admin\Service\AdminService" => array:3 [ …3]
    "Admin\Service\StatisticsService" => array:1 [ …1]
    "Admin\Service\QueueService" => array:1 [ …1]
    "Admin\Service\ApiService" => array:1 [ …1]
    "Admin\Service\OAuth2Service" => array:1 [ …1]
    "Admin\Form\View\Helper\AccessFormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormCheckbox" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterBarElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterColumnElement" => array:2 [ …2]
    "Affiliation\Controller\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\EditController" => array:11 [ …11]
    "Affiliation\Controller\Admin\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\Admin\IndexController" => array:4 [ …4]
    "Affiliation\Controller\Admin\EditController" => array:11 [ …11]
    "Affiliation\Controller\Json\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Json\LoiController" => array:4 [ …4]
    "Affiliation\Controller\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Doa\ManagerController" => array:9 [ …9]
    "Affiliation\Controller\LoiController" => array:5 [ …5]
    "Affiliation\Controller\Loi\ManagerController" => array:7 [ …7]
    "Affiliation\Controller\Questionnaire\CategoryManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireController" => array:4 [ …4]
    "Affiliation\Provider\AffiliationProvider" => array:2 [ …2]
    "Affiliation\Service\AffiliationService" => array:14 [ …14]
    "Affiliation\Service\QuestionnaireService" => array:2 [ …2]
    "Affiliation\Service\DoaService" => array:1 [ …1]
    "Affiliation\Service\LoiService" => array:1 [ …1]
    "Affiliation\Controller\Plugin\RenderPaymentSheet" => array:9 [ …9]
    "Affiliation\Controller\Plugin\RenderLoi" => array:3 [ …3]
    "Affiliation\Controller\Plugin\MergeAffiliation" => array:2 [ …2]
    "Affiliation\View\Helper\PaymentSheet" => array:8 [ …8]
    "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper" => array:1 [ …1]
    "Organisation\Controller\JsonController" => array:3 [ …3]
    "Organisation\Controller\Organisation\NoteController" => array:3 [ …3]
    "Organisation\Controller\ImageController" => array:3 [ …3]
    "Organisation\Controller\BoardController" => array:3 [ …3]
    "Organisation\Controller\Organisation\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Organisation\FinancialController" => array:4 [ …4]
    "Organisation\Controller\Organisation\ListController" => array:2 [ …2]
    "Organisation\Controller\Organisation\ManagerController" => array:7 [ …7]
    "Organisation\Controller\Organisation\TypeController" => array:3 [ …3]
    "Organisation\Controller\AdvisoryBoard\City\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\City\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\AdvisoryBoard\Solution\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\Solution\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\SelectionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ContributionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ManagerController" => array:5 [ …5]
    "Organisation\Controller\Parent\ListController" => array:5 [ …5]
    "Organisation\Controller\Parent\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Parent\OrganisationController" => array:6 [ …6]
    "Organisation\Controller\Parent\TypeController" => array:3 [ …3]
    "Organisation\Controller\Parent\DoaController" => array:6 [ …6]
    "Organisation\Controller\Parent\FinancialController" => array:6 [ …6]
    "Organisation\Controller\UpdateController" => array:4 [ …4]
    "Organisation\Controller\Update\ManagerController" => array:5 [ …5]
    "Organisation\Command\Cleanup" => array:1 [ …1]
    "Organisation\Search\Service\OrganisationSearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => array:1 [ …1]
    "Organisation\View\Handler\OrganisationHandler" => array:9 [ …9]
    "Organisation\View\Handler\AdvisoryBoard\CityHandler" => array:7 [ …7]
    "Organisation\View\Handler\AdvisoryBoard\SolutionHandler" => array:7 [ …7]
    "Organisation\Controller\Plugin\HandleParentAndProjectImport" => array:8 [ …8]
    "Organisation\Controller\Plugin\RenderOverviewExtraVariableContributionSheet" => array:7 [ …7]
    "Organisation\Controller\Plugin\RenderOverviewVariableContributionSheet" => array:8 [ …8]
    "Organisation\Controller\Plugin\Merge\OrganisationMerge" => array:4 [ …4]
    "Organisation\Controller\Plugin\Merge\ParentOrganisationMerge" => array:2 [ …2]
    "Organisation\Controller\Plugin\SelectionExport" => array:2 [ …2]
    "Organisation\Form\OrganisationForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\CityForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\SolutionForm" => array:1 [ …1]
    "Organisation\Form\UpdateForm" => array:1 [ …1]
    "Organisation\Form\FinancialForm" => array:1 [ …1]
    "Organisation\Form\View\Helper\OrganisationFormElement" => array:3 [ …3]
    "Organisation\Form\View\Helper\ParentFormElement" => array:2 [ …2]
    "Organisation\View\Helper\UpdateNotification" => array:2 [ …2]
    "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution" => array:7 [ …7]
    "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution" => array:7 [ …7]
    "Organisation\Service\AdvisoryBoard\CityService" => array:3 [ …3]
    "Organisation\Service\AdvisoryBoard\SolutionService" => array:3 [ …3]
    "Organisation\Service\BoardService" => array:1 [ …1]
    "Organisation\Service\SelectionService" => array:1 [ …1]
    "Organisation\Service\UpdateService" => array:3 [ …3]
    "Publication\Acl\Assertion\Publication" => array:4 [ …4]
    "Publication\Controller\CategoryController" => array:3 [ …3]
    "Publication\Controller\CommunityController" => array:1 [ …1]
    "Publication\Controller\PublicationController" => array:1 [ …1]
    "Publication\Controller\PublicationManagerController" => array:5 [ …5]
    "Publication\Controller\TypeController" => array:4 [ …4]
    "Publication\Search\Service\PublicationSearchService" => array:1 [ …1]
    "Publication\Service\PublicationService" => array:3 [ …3]
    "Invoice\Controller\ConsoleController" => array:1 [ …1]
    "Invoice\Controller\DimensionController" => array:3 [ …3]
    "Invoice\Controller\ExportController" => array:2 [ …2]
    "Invoice\Controller\ForecastController" => array:3 [ …3]
    "Invoice\Controller\InvoiceController" => array:17 [ …17]
    "Invoice\Controller\InvoiceCreateController" => array:15 [ …15]
    "Invoice\Controller\JournalController" => array:1 [ …1]
    "Invoice\Controller\PdfController" => array:1 [ …1]
    "Invoice\Controller\ReminderController" => array:7 [ …7]
    "Invoice\Controller\RowController" => array:4 [ …4]
    "Invoice\Controller\TransactionController" => array:2 [ …2]
    "Invoice\Controller\WordController" => array:1 [ …1]
    "Invoice\Command\DailyUpdate" => array:4 [ …4]
    "Invoice\Command\Sync" => array:1 [ …1]
    "Invoice\Controller\Plugin\CreateCreditInvoice" => array:2 [ …2]
    "Invoice\Controller\Plugin\CreateIncomeForecast" => array:6 [ …6]
    "Invoice\Controller\Plugin\InvoiceExport" => array:3 [ …3]
    "Invoice\Controller\Plugin\InvoiceExportUbl" => array:4 [ …4]
    "Invoice\Controller\Plugin\RenderInvoice" => array:8 [ …8]
    "Invoice\Controller\Plugin\RenderReminder" => array:5 [ …5]
    "Invoice\Controller\Plugin\CreateInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentInvoice" => array:4 [ …4]
    "Invoice\Controller\Plugin\CreateWordInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentExtraInvoice" => array:4 [ …4]
    "Invoice\Service\InvoiceService" => array:9 [ …9]
    "Invoice\Service\TransactionService" => array:3 [ …3]
    "Invoice\Search\Service\InvoiceSearchService" => array:1 [ …1]
    "Invoice\View\Helper\DailyUpdateHandler" => array:2 [ …2]
    "Deeplink\Controller\DeeplinkController" => array:5 [ …5]
    "Deeplink\Controller\TargetController" => array:4 [ …4]
    "Deeplink\InputFilter\TargetFilter" => array:2 [ …2]
    "Deeplink\Service\DeeplinkService" => array:2 [ …2]
    "Deeplink\View\Helper\CanAssemble" => array:1 [ …1]
    "Event\Controller\BadgeImageManagerController" => array:9 [ …9]
    "Event\Controller\BadgeManagerController" => array:13 [ …13]
    "Event\Controller\BoothController" => array:10 [ …10]
    "Event\Controller\BoothManagerController" => array:9 [ …9]
    "Event\Controller\BoothSpecManagerController" => array:4 [ …4]
    "Event\Controller\DeskCostsController" => array:2 [ …2]
    "Event\Controller\ExhibitionCostController" => array:3 [ …3]
    "Event\Controller\ExhibitionSpecManagerController" => array:3 [ …3]
    "Event\Controller\ExhibitionManagerController" => array:5 [ …5]
    "Event\Controller\ExportController" => array:1 [ …1]
    "Event\Controller\JsonController" => array:4 [ …4]
    "Event\Controller\Meeting\AdminController" => array:4 [ …4]
    "Event\Controller\Meeting\MeetingController" => array:9 [ …9]
    "Event\Controller\Meeting\CostController" => array:2 [ …2]
    "Event\Controller\Meeting\QuotaController" => array:4 [ …4]
    "Event\Controller\Meeting\CouponController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionCostController" => array:2 [ …2]
    "Event\Controller\Meeting\FloorplanController" => array:5 [ …5]
    "Event\Controller\Meeting\ManagerController" => array:14 [ …14]
    "Event\Controller\RegistrationController" => array:9 [ …9]
    "Event\Controller\PaymentController" => array:3 [ …3]
    "Event\Controller\RegistrationManagerController" => array:7 [ …7]
    "Event\Controller\TicketManagerController" => array:11 [ …11]
    "Event\Job\CometChat\CreateUser" => array:3 [ …3]
    "Event\Job\CometChat\CreateAuthToken" => array:3 [ …3]
    "Event\Job\CometChat\DeleteUser" => array:3 [ …3]
    "Event\Command\CancelPaymentPending" => array:1 [ …1]
    "Event\Command\UpdateRegistrations" => array:1 [ …1]
    "Event\Controller\Plugin\BoothExport" => array:3 [ …3]
    "Event\Controller\Plugin\RegistrationExport" => array:1 [ …1]
    "Event\Controller\Plugin\RenderReceipt" => array:4 [ …4]
    "Event\Controller\Plugin\MeetingFacebook" => array:4 [ …4]
    "Event\Controller\Plugin\BadgePdf" => array:5 [ …5]
    "Event\Controller\Plugin\TicketPdf" => array:4 [ …4]
    "Event\View\Handler\MeetingHandler" => array:8 [ …8]
    "Event\View\Helper\RegistrationLink" => array:6 [ …6]
    "Event\Search\Service\RegistrationSearchService" => array:1 [ …1]
    "Event\Service\BadgeService" => array:1 [ …1]
    "Event\Service\MeetingService" => array:4 [ …4]
    "Event\Service\ExhibitionService" => array:1 [ …1]
    "Event\Service\BoothService" => array:3 [ …3]
    "Event\Service\RegistrationService" => array:16 [ …16]
    "Event\Service\ExhibitionFloorplanService" => array:1 [ …1]
    "Event\Service\ExhibitionSpecService" => array:1 [ …1]
    "Calendar\Controller\CalendarController" => array:2 [ …2]
    "Calendar\Controller\TypeController" => array:2 [ …2]
    "Calendar\Controller\CommunityController" => array:11 [ …11]
    "Calendar\Controller\DocumentController" => array:4 [ …4]
    "Calendar\Controller\JsonController" => array:1 [ …1]
    "Calendar\Controller\ManagerController" => array:10 [ …10]
    "Calendar\Controller\Plugin\RenderCalendarContactList" => array:3 [ …3]
    "Calendar\Controller\Plugin\RenderReviewCalendar" => array:2 [ …2]
    "Calendar\Service\CalendarService" => array:7 [ …7]
    "Calendar\Search\Service\CalendarSearchService" => array:1 [ …1]
    "Calendar\View\Handler\CalendarHandler" => array:7 [ …7]
    "Mailing\Command\FlushQueue" => array:1 [ …1]
    "Mailing\Command\SendQueue" => array:1 [ …1]
    "Mailing\Controller\AttachmentController" => array:2 [ …2]
    "Mailing\Controller\ConsoleController" => array:1 [ …1]
    "Mailing\Controller\MailingContactController" => array:1 [ …1]
    "Mailing\Controller\MailingManagerController" => array:6 [ …6]
    "Mailing\Controller\JsonController" => array:3 [ …3]
    "Mailing\Controller\MailingSubscriptionController" => array:6 [ …6]
    "Mailing\Controller\SenderManagerController" => array:3 [ …3]
    "Mailing\Controller\TemplateManagerController" => array:3 [ …3]
    "Mailing\InputFilter\MailingFilter" => array:1 [ …1]
    "Mailing\InputFilter\SenderFilter" => array:1 [ …1]
    "Mailing\InputFilter\TemplateFilter" => array:1 [ …1]
    "Mailing\Service\MailingService" => array:4 [ …4]
    "Accounting\Controller\TwinfieldController" => array:2 [ …2]
    "Accounting\Adapter\TwinfieldAdapter" => array:3 [ …3]
  ]
  "lmc_cors" => array:3 [
    "allowed_origins" => array:1 [ …1]
    "allowed_methods" => array:5 [ …5]
    "allowed_headers" => array:3 [ …3]
  ]
  "console" => array:1 [
    "router" => array:1 [ …1]
  ]
  "zfctwig" => array:9 [
    "environment_loader" => "ZfcTwigLoaderChain"
    "environment_class" => "Twig\Environment"
    "environment_options" => array:2 [ …2]
    "loader_chain" => array:3 [ …3]
    "extensions" => array:14 [ …14]
    "suffix" => "twig"
    "enable_fallback_functions" => true
    "disable_zf_model" => false
    "helper_manager" => array:1 [ …1]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [ …6]
    "toolbar" => array:5 [ …5]
    "events" => array:3 [ …3]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:7 [ …7]
    "factories" => array:7 [ …7]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [ …1]
  ]
  "translator" => array:3 [
    "locale" => "en_GB"
    "cache" => true
    "translation_file_patterns" => array:1 [ …1]
  ]
  "web" => array:5 [
    "title" => "ITEA 4"
    "description" => "ITEA is the Eureka R&D&I Cluster programme for software innovation, enabling a large international community to collaborate in funded projects that turn innovative ideas into new businesses, jobs, economic growth and benefits for society."
    "keywords" => "Software-intensive Systems & Services, EUREKA Cluster, R&D, R&D projects, Innovation, Business Impact, Seizing the high ground, Fast Exploitation, Happiness"
    "author" => "Johan van der Heide, johan.van.der.heide[at]itea4.org"
    "site_name" => "itea4.org"
  ]
  "authenticate" => array:1 [
    "useAdditionalEmailAddresses" => true
  ]
  "session_config" => array:3 [
    "cache_expire" => 86400
    "cookie_lifetime" => 86400
    "name" => "itea"
  ]
  "navigation" => array:6 [
    "default" => []
    "project-community" => []
    "community" => array:6 [ …6]
    "admin" => array:14 [ …14]
    "community2" => array:1 [ …1]
    "call" => array:6 [ …6]
  ]
  "content_option" => array:3 [
    "vimeoClientId" => "08fdab5ca150505195e18a91774f67a6bae59cd3"
    "vimeoClientSecret" => "5Dc8mhmhiByGpBp7XFoY7+6rTi5NXGu+OWuU4E97JELWz3oNryFAP0GsbC/h9tvY4KA3dTORoQ31dIk5AGx1HRwjR5t2uXTpZEHMSkWdnjqKi3GFs7acWyzg6mIGEfdV"
    "vimeoAccessToken" => "947086738c8843c59ea7755d410c2288"
  ]
  "general_option" => array:5 [
    "serverUrl" => "https://dev1.itea4.org"
    "thumborServer" => "https://image.itea3.org"
    "thumborSecret" => "mKiWlumnpbX1YWpW6lbm"
    "assets" => "/var/www/dev1/config/itea/../../styles/itea/img"
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "cluster_options" => array:2 [
    "reporting_portal_api_url" => "https://api.eurekaclusters.eu"
    "bearer_token" => "abcd"
  ]
  "slm_queue" => array:6 [
    "job_manager" => array:1 [ …1]
    "queues" => array:1 [ …1]
    "worker_strategies" => array:2 [ …2]
    "strategy_manager" => array:2 [ …2]
    "queue_manager" => array:1 [ …1]
    "worker_manager" => []
  ]
  "project_option" => array:9 [
    "rationale_require_contact_with_funder" => false
    "evaluation_project_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "evaluation_report_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "evaluation_presentation_templates" => array:2 [ …2]
    "evaluation_report_author" => "Itea Office"
    "project_summary_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/project-summary.docx"
    "change_request_document_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/cr-document.docx"
    "header_logo" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/footer.png"
  ]
  "evaluation_options" => array:4 [
    "projectTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "reportTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "presentationTemplates" => array:2 [ …2]
    "reportAuthor" => "ITEA Office"
  ]
  "program_option" => array:6 [
    "nda_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "doa_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "blank_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "has_nda" => true
    "header_logo" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/footer.png"
  ]
  "google" => array:1 [
    "cx" => "009339216969913709813:g_lfsuqxjz0"
  ]
  "solr" => array:2 [
    "host" => "app2"
    "connection" => array:23 [ …23]
  ]
  "admin_option" => array:1 [
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "affiliation_option" => array:3 [
    "doa_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/doa-template.pdf"
    "loi_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/nda-template.pdf"
    "payment_sheet_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "organisation_option" => array:2 [
    "overview_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
    "overview_extra_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
  ]
  "invoice_option" => array:11 [
    "mollie_api_key" => "live_lsaXAz3GAweHE1zzTr15WPt5FEZFeB"
    "payment_days" => 30
    "complaint_days" => 14
    "contract_data_start_year" => 2018
    "invoice_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/pdf/invoice-template.pdf"
    "variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/variable-fee-template.docx"
    "extra_variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/extra-variable-fee-template.docx"
    "invoice_mask" => "YYYY####"
    "local_country" => "NLD"
    "bcc_email_address" => "finance@itea4.org"
    "from_email_address" => "finance@itea4.org"
  ]
  "event_option" => array:1 [
    "receipt_template" => "/var/www/dev1/module/event/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "calendar_option" => array:2 [
    "calendar_contact_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "review_calendar_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/review-calendar-template.pdf"
  ]
  "google_analytics" => array:7 [
    "enable" => true
    "id" => ""
    "domain_name" => ""
    "allow_linker" => false
    "enable_display_advertising" => false
    "anonymize_ip" => false
    "script" => "google-analytics-ga"
  ]
  "accounting_options" => array:5 [
    "clientId" => ""
    "clientSecret" => ""
    "refreshToken" => ""
    "redirectURL" => ""
    "office" => ""
  ]
  "listeners" => array:1 [
    0 => "ErrorHeroModule\Listener\Mvc"
  ]
  "email" => array:3 [
    "general" => array:2 [ …2]
    "smtp" => array:5 [ …5]
    "mailjet" => array:2 [ …2]
  ]
  "log" => array:1 [
    "ErrorHeroModuleLogger" => array:1 [ …1]
  ]
  "error-hero-module" => array:5 [
    "enable" => true
    "enable-error-preview-page" => true
    "display-settings" => array:6 [ …6]
    "logging-settings" => array:1 [ …1]
    "email-notification-settings" => array:5 [ …5]
  ]
  "jield_authorize" => array:6 [
    "default_role" => "public"
    "authenticated_role" => "user"
    "access_service" => "Admin\Service\AdminService"
    "permit_service" => "Contact\Service\ContactService"
    "cache_enabled" => true
    "role_entity_class" => "Admin\Entity\Access"
  ]
  "circlical" => array:1 [
    "recaptcha" => array:3 [ …3]
  ]
  "accounting" => array:2 [
    "adapter" => "Accounting\Adapter\Twinfield"
    "options" => array:7 [ …7]
  ]
  "cache" => array:1 [
    "adapter" => array:2 [ …2]
  ]
  "cometchat" => array:5 [
    "app_id" => "190005357f8fde86"
    "region" => "eu"
    "version" => 2
    "auth_key" => "f333a70ecae8f9362a869d8a5753dea3156109c8"
    "api_key" => "344ac4fb44725064a40306c597afac4ba3430f81"
  ]
  "zfr_cors" => array:1 [
    "allowed_origins" => array:3 [ …3]
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
^ array:3 [
  "modules" => array:63 [
    0 => "Laminas\Cache"
    1 => "Laminas\Router"
    2 => "Laminas\Form"
    3 => "Laminas\Navigation"
    4 => "Laminas\Filter"
    5 => "Laminas\Hydrator"
    6 => "Laminas\InputFilter"
    7 => "Laminas\Paginator"
    8 => "Laminas\Router"
    9 => "Laminas\Log"
    10 => "Laminas\Validator"
    11 => "Laminas\Mvc\Plugin\FlashMessenger"
    12 => "Laminas\Mvc\Plugin\Identity"
    13 => "Laminas\ApiTools"
    14 => "Laminas\ApiTools\Documentation"
    15 => "Laminas\ApiTools\Documentation\Swagger"
    16 => "Laminas\ApiTools\ApiProblem"
    17 => "Laminas\ApiTools\Configuration"
    18 => "Laminas\ApiTools\OAuth2"
    19 => "Laminas\ApiTools\MvcAuth"
    20 => "Laminas\ApiTools\Hal"
    21 => "Laminas\ApiTools\ContentNegotiation"
    22 => "Laminas\ApiTools\ContentValidation"
    23 => "Laminas\ApiTools\Rest"
    24 => "Laminas\ApiTools\Rpc"
    25 => "Laminas\ApiTools\Versioning"
    26 => "Api"
    27 => "LmcCors"
    28 => "AssetManager"
    29 => "ZfcTwig"
    30 => "BjyAuthorize"
    31 => "Jield\Authorize"
    32 => "DoctrineModule"
    33 => "DoctrineORMModule"
    34 => "Application"
    35 => "Content"
    36 => "General"
    37 => "Cluster"
    38 => "News"
    39 => "Contact"
    40 => "Quality"
    41 => "Project"
    42 => "Evaluation"
    43 => "Press"
    44 => "Program"
    45 => "Search"
    46 => "Admin"
    47 => "LaminasBootstrap5"
    48 => "Affiliation"
    49 => "Organisation"
    50 => "Publication"
    51 => "Invoice"
    52 => "Deeplink"
    53 => "Event"
    54 => "Calendar"
    55 => "Mailing"
    56 => "LaminasGoogleAnalytics"
    57 => "Accounting"
    58 => "ErrorHeroModule"
    59 => "CirclicalRecaptcha"
    60 => "SlmQueue"
    61 => "SlmQueueDoctrine"
    62 => "Laminas\DeveloperTools"
  ]
  "module_listener_options" => array:7 [
    "config_glob_paths" => array:2 [
      0 => "config/autoload/{,*.}{global,local}.php"
      1 => "config/itea/{,*.}{global,local}.php"
    ]
    "config_cache_enabled" => false
    "cache_dir" => "/var/www/dev1/config/../data/cache"
    "config_cache_key" => "itea"
    "module_map_cache_enabled" => true
    "module_map_cache_key" => "50b41c6263a4a7e8e9298092a44a713d"
    "module_paths" => array:2 [
      0 => "./module"
      1 => "./vendor"
    ]
  ]
  "service_manager" => array:2 [
    "use_defaults" => true
    "factories" => []
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
BjyAuthorize Current Identity Roles public
BjyAuthorize
Identity Roles - 1 role

public
Doctrine ORM (Queries) 77 queries in 110.50 ms
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.session_id AS session_id_1, t0.session_key AS session_key_2, t0.session_name AS session_name_3, t0.ip AS ip_4, t0.date_start AS date_start_5, t0.date_end AS date_end_6, t0.modified AS modified_7, t0.lifetime AS lifetime_8, t0.hits AS hits_9, t0.data AS data_10, t0.contact_id AS contact_id_11 FROM session t0 WHERE t0.session_key = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'tm0610c19ohs2hklgc5hbca6hj' (length=26)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0019488334655762
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00092506408691406
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00076794624328613
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0015320777893066
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00088882446289062
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1421
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00080680847167969
SQL SELECT t0.content_id AS content_id_1, t0.sequence AS sequence_2, t0.handler_id AS handler_id_3, t0.segment_id AS segment_id_4, t0.node_id AS node_id_5 FROM content t0 WHERE t0.node_id = ? ORDER BY t0.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1421
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00075793266296387
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062894821166992
SQL SELECT t0.article_id AS article_id_1, t0.article AS article_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.sequence AS sequence_5, t0.body AS body_6, t0.css AS css_7, t0.hide_from_navigation AS hide_from_navigation_8, t0.article_in_title AS article_in_title_9, t0.topic_id AS topic_id_10 FROM article t0 WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0006711483001709
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 745
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00068807601928711
SQL SELECT t0.article_id AS article_id_1, t0.article AS article_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.sequence AS sequence_5, t0.body AS body_6, t0.css AS css_7, t0.hide_from_navigation AS hide_from_navigation_8, t0.article_in_title AS article_in_title_9, t0.topic_id AS topic_id_10 FROM article t0 WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00061392784118652
SQL SELECT t0.article_id AS article_id_1, t0.article AS article_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.sequence AS sequence_5, t0.body AS body_6, t0.css AS css_7, t0.hide_from_navigation AS hide_from_navigation_8, t0.article_in_title AS article_in_title_9, t0.topic_id AS topic_id_10 FROM article t0 WHERE t0.article_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 144
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067687034606934
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN article_access ON t0.access_id = article_access.access_id WHERE article_access.article_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 144
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00083398818969727
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 24
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053977966308594
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00057196617126465
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00059294700622559
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 95
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010130405426025
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00063180923461914
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00052309036254883
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0004570484161377
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054788589477539
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057792663574219
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050091743469238
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'Page-container with ITEA 4 header image grey dots ' (length=50)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00063300132751465
SQL SELECT t0.segment_id AS segment_id_1, t0.segment AS segment_2 FROM content_segment t0 WHERE t0.segment_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065183639526367
SQL SELECT t0.param_id AS param_id_1, t0.param AS param_2 FROM content_handler_param t0 WHERE t0.param_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 32
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054717063903809
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 724
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054597854614258
SQL SELECT t0.challenge_id AS challenge_id_1, t0.challenge AS challenge_2, t0.docref AS docref_3, t0.prefix AS prefix_4, t0.sequence AS sequence_5, t0.html AS html_6, t0.css AS css_7, t0.sources AS sources_8, t0.abstract AS abstract_9, t0.background_image AS background_image_10, t0.backcolor AS backcolor_11, t0.frontcolor AS frontcolor_12, t0.type_id AS type_id_13, t14.image_id AS image_id_15, t14.image AS image_16, t14.date_updated AS date_updated_17, t14.contenttype_id AS contenttype_id_18, t14.challenge_id AS challenge_id_19, t20.icon_id AS icon_id_21, t20.icon AS icon_22, t20.date_updated AS date_updated_23, t20.contenttype_id AS contenttype_id_24, t20.challenge_id AS challenge_id_25, t26.image_id AS image_id_27, t26.image AS image_28, t26.date_updated AS date_updated_29, t26.contenttype_id AS contenttype_id_30, t26.challenge_id AS challenge_id_31, t32.icon_id AS icon_id_33, t32.icon AS icon_34, t32.date_updated AS date_updated_35, t32.contenttype_id AS contenttype_id_36, t32.challenge_id AS challenge_id_37, t38.pdf_id AS pdf_id_39, t38.pdf AS pdf_40, t38.date_created AS date_created_41, t38.date_end AS date_end_42, t38.challenge_id AS challenge_id_43 FROM challenge t0 LEFT JOIN challenge_image t14 ON t14.challenge_id = t0.challenge_id LEFT JOIN challenge_icon t20 ON t20.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_image t26 ON t26.challenge_id = t0.challenge_id LEFT JOIN challenge_idea_poster_icon t32 ON t32.challenge_id = t0.challenge_id LEFT JOIN challenge_pdf t38 ON t38.challenge_id = t0.challenge_id WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00098896026611328
SQL SELECT c0_.challenge_id AS challenge_id_0, c0_.challenge AS challenge_1, c0_.docref AS docref_2, c0_.prefix AS prefix_3, c0_.sequence AS sequence_4, c0_.html AS html_5, c0_.css AS css_6, c0_.sources AS sources_7, c0_.abstract AS abstract_8, c0_.background_image AS background_image_9, c0_.backcolor AS backcolor_10, c0_.frontcolor AS frontcolor_11, c0_.type_id AS type_id_12 FROM challenge c0_ INNER JOIN challenge_type c1_ ON c0_.type_id = c1_.type_id WHERE c1_.active_for_calls = ? ORDER BY c0_.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0016860961914062
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00059986114501953
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00075912475585938
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0086581707000732
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010111331939697
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0076470375061035
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 9
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067400932312012
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 9
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054097175598145
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 9
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0040788650512695
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 9
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00070595741271973
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 9
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0033230781555176
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067496299743652
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00059199333190918
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.002586841583252
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062799453735352
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0037338733673096
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061917304992676
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054693222045898
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0041549205780029
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071597099304199
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0053458213806152
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067496299743652
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058102607727051
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0039529800415039
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006871223449707
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 11
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0035340785980225
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 55
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0055630207061768
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 55
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067996978759766
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 55
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00053095817565918
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 55
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00048613548278809
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 55
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054788589477539
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005497932434082
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054192543029785
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0022680759429932
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00084590911865234
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0037901401519775
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00058984756469727
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054478645324707
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_image t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0033397674560547
SQL SELECT t0.icon_id AS icon_id_1, t0.icon AS icon_2, t0.date_updated AS date_updated_3, t0.contenttype_id AS contenttype_id_4, t0.challenge_id AS challenge_id_5 FROM challenge_idea_poster_icon t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006868839263916
SQL SELECT t0.pdf_id AS pdf_id_1, t0.pdf AS pdf_2, t0.date_created AS date_created_3, t0.date_end AS date_end_4, t0.challenge_id AS challenge_id_5 FROM challenge_pdf t0 WHERE t0.challenge_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0041840076446533
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00083398818969727
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'scope-and-research-areas' (length=24)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00066208839416504
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.topic_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 48
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00055098533630371
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1477
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00073409080505371
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1504
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078701972961426
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.node_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00069999694824219
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1593
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00067400932312012
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1587
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063180923461914
Doctrine ORM (Mappings) 389 mappings
DoctrineORMModule Mappings for doctrine.mapping_collector.orm_default