ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 is the Eureka Cluster on software innovation
ITEA 4 header image old-green golden ratio

ITEA Success stories

Find here the overview of the Success stories

FUSE-IT Success story

10 March 2021


FUSE-IT project image.jpg
Fuse-IT will address the need for sustainable, reliable, userfriendly, efficient, safe and secure Building Management System (BMS) in the context of smart critical sites. A main purpose is to solve the dilemma between efficiency and security in intelligent & strategic buildings. The result of FUSE-IT will be a smart secured building system, incorporating secured share sensors, effectors and devices strongly interconnected through trusted federated energy & information networks, a core building data processing & analysis module, a smart unified building management interface and a full security dashboard. Remote multisite monitoring will be implemented, taking advantage of big data analytics.

Read more

3DPathology Success story

10 March 2021


3DPathology project image.jpg
A strong growth forecast in the digital pathology market for the next five years combined with a decreasing number of qualified pathologists will lead to a tremendous increase in workload in the pathology departments of clinical and pharmaceutical organisations. On top of this there is an urgent need for higher quality diagnostic information enabling more effective and efficient treatments. The 3DPathology project will address these needs by creating a fast, digital, quantitative, spectroscopic and multimodal 3D pathology analysis system.

Read more

C³PO Success story

12 November 2020


C3PO.jpg
C³PO aims at providing a Cloud collaborative and semantic platform for city co-design. The C³PO platform is unique in that it covers the whole urban project development process where cities empower, encourage and guide different stakeholders (citizens, decision makers, architects, etc.) to develop an urban project together. C³PO does not intend to replace or modify the existing applications offering unique but partial solutions of city co-design (simulation tool, open API, 3D modelling and visualisation, gaming tool, etc.) but can be seen as an open and generic intermediary that enables the interaction between existing applications through a unique multi-dimensional semantic repository (covering the different types of information in city codesign like GIS, BIM, electricity grids, traffic, etc.). As such, C³PO will enable the capitalisation of existing applications and data sources by enabling their integration as services, or by enabling them to exploit the C³PO Open API

Read more

ITEA Success story: ACOSAR

12 November 2020


ACOSAR project showcase
Virtual system development (“frontloading”) is getting more and more important in a plenitude of industrial domains to reduce development times, stranded costs and time-to-market. Co-simulation is a particularly promising approach for interoperable modular development. However, the coupling and integration of real-time systems into simulation environments (especially of systems of distributed HiL systems and simulations) still requires enormous effort. The aim of ACOSAR is to develop both a non-proprietary “Distributed Co-simulation Protocol” (DCP) for integration of simulation and testing environments and an according integration methodology, which shall be a substantial contribution to international standardization (FMI). The results of ACOSAR will lead to a modular, considerably more flexible as well as shorter system development process for numerous industrial domains and will enable the establishment of new business models.

Read more

SCALARE Success Story

01 July 2020


Success story SCALARE
Most product innovations today are enabled through software components, so it is no surprise that software is the primary means of competitive differentiation. Software plays a key role in the digitalisation of many products that hitherto were completely driven by electronics, so scaling software in a controlled and efficient way is crucial, and represents a major challenge for organisations. The required transformations are often driven by the technological evolution of products, systems or services as well as by how the business and the company are organised. In many instances, existing processes must be reshaped, and new best practices and tools incorporated. The challenge taken up by the ITEA project SCALARE, a joint effort of industry and academia from five countries, was how to support and enable organisations in scaling their software capability in a systematic, proactive way.

Read more

M2MGrids Success Story

01 July 2020


M2MGrids Success story
The M2MGrids project aimed at creating enablers for a dynamic cyber-physical information ecosystem that would interoperate in real time with the business processes of companies with real-life objects, people and things. M2MGrids focused on major disruptions in targeted energy and mobility domains. The disruption in the energy domain was related to operating models and the high cost of peak hours in energy grids. To make more efficient use of the energy grid, there needed to be a flexible and automated means by which to control both consumption and generation between multiple energy stakeholders and prosumers. The inability of multiple stakeholder systems to exchange information in dynamic situations (such as in a traffic accident) was leading to disruptions in the mobility domain.

Read more

ACCELERATE Success Story

10 March 2020


ACCELERATE Success Story Magazine footer
Innovation is much more than creating technology; it must ‘go to market’. Many companies need new ways to rapidly validate the match between the market and their innovative ICT-intensive technology. The ITEA project ACCELERATE took up the challenge of enabling the mass adoption of acceleration knowhow by European technology companies by focusing on two goals: the transfer of knowledge on a massive scale and the introduction of a new type of product development, the so-called validated learning process that systematically searches for the technology-market match by validating the mechanics of a business model. This way ACCELERATE set out to shorten the innovation cycle and time-to-market, and to increase the number of new products or solutions as well as the number of ideas that are accelerated and/or created.

Read more

BENEFIT Success Story

10 March 2020


BENEFIT project image.jpg
Three main challenges were confronted by the BENEFIT project. Firstly, there is the societal aspect of coping with the increasing number of minimally invasive image guided interventions. Secondly, the economic dimension concerns delivering care with quantified targets in terms of quantity, price and quality of care. The third element was to show the technical feasibility of an integrated infrastructure that includes all relevant imaging and data sources, the modelling, analysis and presentation of these data and the integration into a Clinical Decision Support System. The BENEFIT project addressed these challenges by developing new imaging procedures and quantification and analysis methods to collect information before, during and at the end of an interventional treatment.

Read more

MODRIO Success story

01 November 2019


MODRIO showcase
Cyber-physical systems (CPS) are very large systems that not only involve a large number of stakeholders but are safety critical and have significant impact on the economy and the environment as well. This makes tools for the safe and efficient design and operation of such systems imperative. The ITEA project MODRIO, which ran from 2012 to 2016, was set up to extend modelling and simulation tools based on open standards (Modelica and FMI) from system design to system operation.

Read more

OPEES Success story

01 November 2019


OPEES_small.png
The ITEA 2 project OPEES stood at the inception of two important trends: open collaboration with open source in industry and open source tools for model-based systems engineering (MBSE). Neither of these trends were well developed in 2009, but almost 10 years later, and with acceleration through the OPEES project, we benefit from both good open source MBSE tools and many open collaboration initiatives in industry. OPEES was both a pioneer and a catalyst in this evolution.

Read more

SoRTS Success story

01 July 2019


SoRTS footer image
Radiotherapy affects not only cancer cells but also healthy cells in the area that is being treated, so it is important that as little healthy tissue as possible is affected. The problem is that the movement of a tumour under the effect of respiration, for example, risks damaging surrounding tissue, whereas MRI, the only imaging modality that can visualise the tumour well, traditionally takes minutes to create the image. Thanks to the strong results from the ITEA SoRTS project, physicians can now precisely target a tumour, even when tumour tissue changes shape, location, size or composition during treatment. Patients benefit from a less intrusive treatment enabling them to continue their daily lives.

Read more

Metaverse1 Success story

27 June 2019


Magazine newsletter image Metaverse1
Ten years ago, virtual worlds were already found in serious computer games and simulation models. However, they were mostly standalone and independent of each other with little or no connection to the real world. The ITEA project Metaverse1 set out to overcome this isolation – defining a standard to enable connectivity and interoperability between virtual worlds and with the real world. The objective was to define interoperability in such a way that it would be possible to exchange information between worlds. Even more important was the development of a standard interface between the real physical world and the virtual – simulation/ serious games – world. This made it possible to attach real world sensors, such as body parameter or environmental sensors, to provide input to simulations or alternatively obtain feedback from such models into the real world, for example to control lighting, temperature or ventilation or for personal wellbeing.

Read more

AMALTHEA and AMALTHEA4public Success story

12 March 2019


AMALTHEA project image
The ITEA 2 projects AMALTHEA and AMALTHEA4public are part of a 'string of pearls' in the automotive domain; successes that have pushed this domain into the next phase of its development. AUTOSAR, a result from the former ITEA project EAST-EEA, defined a methodology for component-based development of automotive software and a standardised software architecture for automotive electronic control units. However, AUTOSAR offered only limited support for detailed behaviour descriptions, which are indispensable for developing much more complex multi-core systems of high quality. Those require an increased exchange between tools. Multi-core optimisation especially relies on additional information like detailed timing behaviour. AMALTHEA set about adapting existing development methods and tools and creating a common model that offers the required description capabilities on different abstraction levels. The follow-up project AMALTHEA4public was set up to foster the transfer into application and to create a sustainable open (“public”) platform and a vibrant community of users and contributors.

Read more

·

MoSHCA Success story

06 March 2019


MOSHCA project image.jpg
The number of people experiencing chronic disease is increasing dramatically worldwide. The impact of chronic diseases is evident: it has been estimated that the cost of five of the major chronic illnesses could reach USD 47 trillion over the next 20 years and could claim almost 400 million lives within 10 years. The ITEA 2 MoSHCA project was geared towards improving patient-doctor interactions, controlling chronic diseases, developing technological set-ups that significantly improve the self-management of chronic illnesses, promoting communication between the patient and the health provider and supporting health staff in providing better clinical follow-up.

Read more

UsiXML Success story

06 March 2019


UsiXML language
The international landscape is quite diverse in terms of interactive software systems as they should be used in a wide spectrum of contexts of use. Each context of use covers various types of users along with their interactive tasks, using potentially several computing platforms or devices in multiple physical, organisational and psychological environments and locations. In addition, practices for developing user interfaces of these interactive software systems are even more heterogeneous. Evolving in so many diverse contexts of use is particularly challenging when the same system should be deployed for several targets. In theory, a single version of the software should be produced so that it is adapted to each context of use. In practice, this is simply impossible to do due to lack of resources and knowledge

Read more

H4H Success story

15 November 2018


ITEA Magazine 30 - Thumbnail H4H.png
HPC is essential in meeting the demand for increased processing power for future research and development in many domains. The goal of the ITEA project H4H was to provide a highly efficient, hybrid programming environment for heterogeneous computing clusters to enable easier development of HPC applications and optimise application performance. The project also aimed at providing a new infrastructure for HPC cloud computing and a new cooling technology to reduce energy needed to operate the HPC system.

Read more

ATAC Success story

15 November 2018


ITEA Magazine 30 - Thumbnail ATAC.png
Due to the dramatic increase in the complexity of the software itself and the sheer magnitude of the customisability of the software, software-intensive systems have become increasingly difficult to develop and verify by traditional development processes and testing methods.The ITEA project ATAC aimed to resolve such challenges. The overarching goal was to push the functional, safety and security requirements coverage envelope while greatly reducing the required testing effort for both the fully automated and remaining manual test cases.

Read more

BaaS Success story

02 July 2018


ITEA Magazine 30 - Thumbnail BaaS.png
Smart buildings of the future need comprehensive and extendible cross-domain management and control functionality that today’s building automation and management systems (BAS) do not adequately provide. The BaaS (Building as a Service) project was set out to tackle these challenges by introducing a novel semantic IoT service framework for commercial buildings along with a reference architecture and corresponding software platform as a basis for current and future commercial building automation and management technologies.

Read more

CAP Success story

15 March 2018


Thumbnail CAP.png
Nowadays, a wealth of data is available. However the access to efficient analytic tools is often difficult. The ITEA project CAP (Collaborative Analytic Platform), contributed to the development of new sustainable business models and laid the foundation for a market value proposition of ‘Big Data as a Service’. Thanks to the project results, La Poste will be able to save several million euros with the same control workforces.

Read more

SEAS Success story

20 November 2017


Thumbnail-SEAS.png
SEAS was set out to enable interoperability of energy, ICT and automation systems at consumption sites, introducing dynamic ICT-based solutions to control, monitor and estimate energy consumption. According to Engie's CTO: "SEAS is a standard that will allow any kind of energy to be transferred securely and automatically with embedded artificial intelligence between devices that either produce, store or consume. This is a really, really major development in the IoT for energy, one that is going to transform the future."

Read more

·

SAFE Success story

31 March 2017


SAFE_success_story
Driving on the road is a way of life - whether for work or for leisure. Being able to get safely from A to B is something we take for granted. And today driving is safer than it was ten years ago, and ten years before that, and in ten years time it will be even safer. This progress can be measured - fewer accidents, fewer injuries, fewer deaths = less cost to society, in both human, financial and environmental terms. So the benefits of safe driving are crystal clear. But to get to that stage, a lot has gone on, and is still going on, behind the scenes and particularly in the software that has become the key ingredient of every modern mode of transport, the road vehicle being no exception.

Read more

·

Philips Healthcare Success story

27 October 2016


Thumbnail Healthcare synthesis.jpg
Recent decades have witnessed phenomenal advances in healthcare. But the combination of longevity, chronic disease and costs have made the need for smart solutions paramount. The growing presence of healthcare in the RD&I landscape has been making its mark within the ITEA Community, so time to reflect on the input and impact of Philips over the past seven or so years. This brief retrospective of Philips' very active involvement in the (smart) healthcare projects within the ITEA Community bears testimony to the key role it has played and continues to play, one that benefits business, users, knowledge and, most important of all, patients.

Read more

· · ·

ADAX Success story

27 October 2016


Thumbnail ADAX.jpg
The ADAX project started in early 2013, aiming at developing advanced capabilities for cyber-Attack Detection And Countermeasures Simulation. The consortium was comprised of 8 partners from France and Turkey including 2 large enterprise, 4 SMEs, 2 academics. Airbus DS Cybersecurity (Cassidian CyberSecurity SAS) acted as Project Coordinator while Yapi Kredi Bank acted as pilot end user. The project duration was 30 months for a total effort of 86 person-years.

Read more

DIAMONDS Success story

30 June 2016


DIAMONDS project showcase
With the DIAMONDS methodology representing a unique enabling technology for testing the security of critical software systems, the project continues to deliver results years after it ended. Several standardisation documents have been adopted by the European Telecommunications Standards Institute (ETSI), for example, and have been forwarded to international standardisation bodies. These standardisation documents reflect the project's case studies, where the partners fine-tuned the methodology for different industrial sectors.

Read more

NEXO Success story

31 March 2016


Magazine 23 - thumbnail NEXO
The ITEA EPAS project was initiated several years ago in the framework of the SEPA (Single Euro Payments Area) project led by the European Central Bank and with the strong support of the European Commission. SEPA aimed at facilitating payments in Europe beyond national borders in order to achieve a single domestic market of payments. The project, eventually retained by ITEA for funding, gathered various actors belonging to the European card payment industry such as Groupement des Cartes Bancaires, Ingenico, ATOS Worldline, Verifone, Wincor-Nixdorf, Total, Equens and many others. The aim of this project was to involve the main actors of the card payment industry to deliver global standards that would enable European retailers to rely on common specifications for their card acquiring operations.

Read more

32 results on 2 pages

Laminas
Documentation Modules Gallery PHP Version 8.0.14 Extensions intl ModulesLaminas\CacheLaminas\RouterLaminas\FormLaminas\NavigationLaminas\FilterLaminas\HydratorLaminas\InputFilterLaminas\PaginatorLaminas\LogLaminas\ValidatorLaminas\Mvc\Plugin\FlashMessengerLaminas\Mvc\Plugin\IdentityLaminas\ApiToolsLaminas\ApiTools\DocumentationLaminas\ApiTools\Documentation\SwaggerLaminas\ApiTools\ApiProblemLaminas\ApiTools\ConfigurationLaminas\ApiTools\OAuth2Laminas\ApiTools\MvcAuthLaminas\ApiTools\HalLaminas\ApiTools\ContentNegotiationLaminas\ApiTools\ContentValidationLaminas\ApiTools\RestLaminas\ApiTools\RpcLaminas\ApiTools\VersioningApiLmcCorsAssetManagerZfcTwigBjyAuthorizeJield\AuthorizeDoctrineModuleDoctrineORMModuleApplicationContentGeneralClusterNewsContactQualityProjectEvaluationPressProgramSearchAdminLaminasBootstrap5AffiliationOrganisationPublicationInvoiceDeeplinkEventCalendarMailingLaminasGoogleAnalyticsAccountingErrorHeroModuleCirclicalRecaptchaSlmQueueSlmQueueDoctrineLaminas\DeveloperTools
Request and Response 200 NodeController::node on content-route-1
Status code 200 Method GET Controller Content\Controller\NodeController Action node Other Route Parameters
^ array:1 [
  "docRef" => "success-stories"
]
Route content-route-1 Template layout/layout

  content: string

Template content/node/node

  node: Content\Entity\Node

Execution Time 542.58 ms
1. route 99.59 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
2. authentication 102.70 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
3. authentication.post 102.94 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
4. authorization 103.04 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
5. authorization.post 103.17 ms
File: src/EventManager.php - Line: 319
Target: Laminas\ApiTools\MvcAuth\MvcRouteListener
6. dispatch 148.30 ms
File: public/index.php - Line: 31
Target: Laminas\Mvc\Application
7. dispatch 148.97 ms
File: src/DispatchListener.php - Line: 132
Target: Content\Controller\NodeController
8. render 152.37 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
9. renderer 167.16 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
10. renderer.post 167.26 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
11. renderer 167.33 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
12. renderer.post 167.39 ms
File: src/View.php - Line: 222
Target: Laminas\View\View
13. isAllowed 525.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
14. isAllowed 525.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
15. isAllowed 525.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
16. isAllowed 525.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
17. isAllowed 525.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
18. isAllowed 525.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
19. isAllowed 525.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
20. isAllowed 525.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
21. isAllowed 526.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
22. isAllowed 526.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
23. isAllowed 526.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
24. isAllowed 526.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
25. isAllowed 526.22 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
26. isAllowed 526.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
27. isAllowed 526.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
28. isAllowed 526.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
29. isAllowed 526.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
30. isAllowed 526.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
31. isAllowed 526.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
32. isAllowed 526.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
33. isAllowed 526.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
34. isAllowed 526.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
35. isAllowed 526.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
36. isAllowed 526.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
37. isAllowed 526.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
38. isAllowed 526.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
39. isAllowed 527.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
40. isAllowed 527.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
41. isAllowed 527.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
42. isAllowed 527.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
43. isAllowed 527.23 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
44. isAllowed 527.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
45. isAllowed 527.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
46. isAllowed 527.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
47. isAllowed 527.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
48. isAllowed 527.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
49. isAllowed 527.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
50. isAllowed 527.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
51. isAllowed 527.69 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
52. isAllowed 527.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
53. isAllowed 527.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
54. isAllowed 527.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
55. isAllowed 527.91 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
56. isAllowed 527.97 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
57. isAllowed 528.02 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
58. isAllowed 528.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
59. isAllowed 528.28 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
60. isAllowed 528.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
61. isAllowed 528.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
62. isAllowed 528.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
63. isAllowed 528.50 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
64. isAllowed 528.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
65. isAllowed 528.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
66. isAllowed 528.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
67. isAllowed 528.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
68. isAllowed 528.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
69. isAllowed 528.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
70. isAllowed 528.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
71. isAllowed 528.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
72. isAllowed 528.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
73. isAllowed 529.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
74. isAllowed 529.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
75. isAllowed 529.76 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
76. isAllowed 529.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
77. isAllowed 529.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
78. isAllowed 530.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
79. isAllowed 530.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
80. isAllowed 530.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
81. isAllowed 530.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
82. isAllowed 530.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
83. isAllowed 530.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
84. isAllowed 530.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
85. isAllowed 530.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
86. isAllowed 530.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
87. isAllowed 530.99 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
88. isAllowed 531.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
89. isAllowed 531.19 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
90. isAllowed 531.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
91. isAllowed 531.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
92. isAllowed 531.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
93. isAllowed 531.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
94. isAllowed 531.86 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
95. isAllowed 531.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
96. isAllowed 532.09 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
97. isAllowed 532.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
98. isAllowed 532.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
99. isAllowed 532.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
100. isAllowed 532.58 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
101. isAllowed 532.77 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
102. isAllowed 532.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
103. isAllowed 532.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
104. isAllowed 533.03 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
105. isAllowed 533.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
106. isAllowed 533.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
107. isAllowed 533.40 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
108. isAllowed 533.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
109. isAllowed 533.61 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
110. isAllowed 533.80 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
111. isAllowed 533.85 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
112. isAllowed 534.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
113. isAllowed 534.05 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
114. isAllowed 534.20 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
115. isAllowed 534.25 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
116. isAllowed 534.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
117. isAllowed 534.45 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
118. isAllowed 534.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
119. isAllowed 534.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
120. isAllowed 534.81 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
121. isAllowed 535.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
122. isAllowed 535.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
123. isAllowed 535.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
124. isAllowed 535.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
125. isAllowed 535.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
126. isAllowed 535.46 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
127. isAllowed 535.66 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
128. isAllowed 535.71 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
129. isAllowed 535.88 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
130. isAllowed 535.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
131. isAllowed 536.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
132. isAllowed 536.15 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
133. isAllowed 536.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
134. isAllowed 536.34 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: LaminasBootstrap5\View\Helper\Navigation\Menu
135. isAllowed 536.94 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
136. isAllowed 537.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
137. isAllowed 537.07 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
138. isAllowed 537.14 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
139. isAllowed 537.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
140. isAllowed 537.26 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
141. isAllowed 537.33 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
142. isAllowed 537.38 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
143. isAllowed 537.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
144. isAllowed 537.49 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
145. isAllowed 537.55 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
146. isAllowed 537.60 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
147. isAllowed 537.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
148. isAllowed 537.72 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
149. isAllowed 537.79 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
150. isAllowed 537.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
151. isAllowed 537.90 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
152. isAllowed 537.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
153. isAllowed 538.01 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
154. isAllowed 538.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
155. isAllowed 538.12 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
156. isAllowed 538.17 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
157. isAllowed 538.24 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
158. isAllowed 538.29 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
159. isAllowed 538.36 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
160. isAllowed 538.41 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
161. isAllowed 538.47 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
162. isAllowed 538.53 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
163. isAllowed 538.59 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
164. isAllowed 538.64 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
165. isAllowed 538.70 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
166. isAllowed 538.75 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
167. isAllowed 538.82 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
168. isAllowed 538.87 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
169. isAllowed 538.93 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
170. isAllowed 538.98 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
171. isAllowed 539.04 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
172. isAllowed 539.10 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
173. isAllowed 539.16 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
174. isAllowed 539.21 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
175. isAllowed 539.27 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
176. isAllowed 539.32 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
177. isAllowed 539.39 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
178. isAllowed 539.44 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
179. isAllowed 539.51 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
180. isAllowed 539.56 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
181. isAllowed 539.62 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
182. isAllowed 539.67 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
183. isAllowed 539.73 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
184. isAllowed 539.78 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
185. isAllowed 539.84 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
186. isAllowed 539.89 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
187. isAllowed 539.95 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
188. isAllowed 540.00 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
189. isAllowed 540.06 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
190. isAllowed 540.11 ms
File: Navigation/AbstractHelper.php - Line: 329
Target: Laminas\View\Helper\Navigation\Breadcrumbs
191. response 541.68 ms
File: Http/DefaultRenderingStrategy.php - Line: 98
Target: Laminas\View\View
192. finish 541.78 ms
File: src/Application.php - Line: 341
Target: Laminas\Mvc\Application
193. collected 1.02 s
File: Listener/ProfilerListener.php - Line: 86
Target: NULL
Total Time 542.58 ms
Memory Peak 2.00 MB
1. route 2.00 MB

public/index.php - Line: 31

2. authentication 2.00 MB

src/EventManager.php - Line: 319

3. authentication.post 2.00 MB

src/EventManager.php - Line: 319

4. authorization 2.00 MB

src/EventManager.php - Line: 319

5. authorization.post 2.00 MB

src/EventManager.php - Line: 319

6. dispatch 2.00 MB

public/index.php - Line: 31

7. dispatch 2.00 MB

src/DispatchListener.php - Line: 132

8. render 2.00 MB

src/Application.php - Line: 341

9. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

10. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

11. renderer 2.00 MB

src/View.php - Line: 222

12. renderer.post 2.00 MB

src/View.php - Line: 222

13. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

14. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

15. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

16. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

17. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

18. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

19. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

20. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

21. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

22. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

23. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

24. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

25. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

26. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

27. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

28. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

29. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

30. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

31. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

32. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

33. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

34. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

35. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

36. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

37. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

38. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

39. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

40. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

41. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

42. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

43. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

44. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

45. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

46. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

47. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

48. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

49. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

50. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

51. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

52. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

53. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

54. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

55. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

56. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

57. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

58. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

59. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

60. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

61. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

62. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

63. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

64. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

65. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

66. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

67. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

68. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

69. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

70. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

71. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

72. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

73. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

74. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

75. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

76. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

77. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

78. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

79. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

80. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

81. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

82. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

83. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

84. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

85. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

86. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

87. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

88. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

89. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

90. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

91. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

92. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

93. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

94. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

95. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

96. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

97. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

98. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

99. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

100. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

101. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

102. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

103. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

104. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

105. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

106. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

107. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

108. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

109. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

110. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

111. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

112. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

113. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

114. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

115. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

116. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

117. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

118. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

119. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

120. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

121. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

122. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

123. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

124. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

125. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

126. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

127. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

128. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

129. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

130. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

131. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

132. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

133. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

134. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

135. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

136. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

137. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

138. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

139. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

140. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

141. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

142. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

143. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

144. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

145. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

146. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

147. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

148. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

149. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

150. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

151. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

152. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

153. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

154. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

155. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

156. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

157. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

158. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

159. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

160. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

161. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

162. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

163. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

164. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

165. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

166. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

167. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

168. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

169. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

170. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

171. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

172. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

173. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

174. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

175. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

176. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

177. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

178. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

179. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

180. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

181. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

182. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

183. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

184. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

185. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

186. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

187. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

188. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

189. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

190. isAllowed 2.00 MB

Navigation/AbstractHelper.php - Line: 329

191. response 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 98

192. finish 2.00 MB

src/Application.php - Line: 341

193. collected 2.00 MB

Listener/ProfilerListener.php - Line: 86

Memory Peak 2.00 MB
Config Config
Merged Config (Config)
^ array:66 [
  "service_manager" => array:7 [
    "abstract_factories" => array:11 [
      0 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      1 => "Laminas\Form\FormAbstractServiceFactory"
      2 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      3 => "Laminas\Log\LoggerAbstractServiceFactory"
      4 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      6 => "Laminas\ApiTools\DbConnectedResourceAbstractFactory"
      7 => "Laminas\ApiTools\TableGatewayAbstractFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      8 => "Laminas\Navigation\Service\NavigationAbstractServiceFactory"
      9 => "Laminas\Log\LoggerAbstractServiceFactory"
    ]
    "factories" => array:731 [
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\Navigation\Navigation" => "Laminas\Navigation\Service\DefaultNavigationFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "Laminas\ApiTools\MvcAuth\UnauthenticatedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\UnauthorizedListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\Factory\ApiFactoryFactory"
      "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategyFactory"
      "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Factory\RenderErrorListenerFactory"
      "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Factory\SendApiProblemResponseListenerFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemRendererFactory"
      "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\Factory\ApiProblemStrategyFactory"
      "Laminas\ApiTools\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\Factory\ConfigResourceFactory"
      "Laminas\ApiTools\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\Factory\ResourceFactoryFactory"
      "Laminas\ApiTools\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\Factory\ConfigWriterFactory"
      "Laminas\ApiTools\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\Factory\ModuleUtilsFactory"
      "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter" => "Application\Authentication\Factory\PdoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Factory\MongoAdapterFactory"
      "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationServiceFactory"
      "Laminas\ApiTools\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\MvcAuth\Factory\NamedOAuth2ServerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication" => "Laminas\ApiTools\MvcAuth\Factory\AuthenticationServiceFactory"
      "Laminas\ApiTools\MvcAuth\ApacheResolver" => "Laminas\ApiTools\MvcAuth\Factory\ApacheResolverFactory"
      "Laminas\ApiTools\MvcAuth\FileResolver" => "Laminas\ApiTools\MvcAuth\Factory\FileResolverFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthenticationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\AuthHttpAdapter" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthHttpAdapterFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization" => "Laminas\ApiTools\MvcAuth\Factory\AclAuthorizationFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultAuthorizationListenerFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultResourceResolverListener" => "Laminas\ApiTools\MvcAuth\Factory\DefaultResourceResolverListenerFactory"
      "Laminas\Authentication\Storage\NonPersistent" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\MvcAuth\Authorization\DefaultAuthorizationPostListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Factory\LinkExtractorFactory"
      "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Factory\LinkCollectionExtractorFactory"
      "Laminas\ApiTools\Hal\HalConfig" => "Laminas\ApiTools\Hal\Factory\HalConfigFactory"
      "Laminas\ApiTools\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\Factory\HalJsonRendererFactory"
      "Laminas\ApiTools\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\Factory\HalJsonStrategyFactory"
      "Laminas\ApiTools\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Factory\LinkUrlBuilderFactory"
      "Laminas\ApiTools\Hal\MetadataMap" => "Laminas\ApiTools\Hal\Factory\MetadataMapFactory"
      "Laminas\ApiTools\Hal\RendererOptions" => "Laminas\ApiTools\Hal\Factory\RendererOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\AcceptFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\AcceptFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentTypeFilterListener" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentTypeFilterListenerFactory"
      "Laminas\ApiTools\ContentNegotiation\ContentNegotiationOptions" => "Laminas\ApiTools\ContentNegotiation\Factory\ContentNegotiationOptionsFactory"
      "Laminas\ApiTools\ContentNegotiation\HttpMethodOverrideListener" => "Laminas\ApiTools\ContentNegotiation\Factory\HttpMethodOverrideListenerFactory"
      "Laminas\ApiTools\ContentValidation\ContentValidationListener" => "Laminas\ApiTools\ContentValidation\ContentValidationListenerFactory"
      "Laminas\ApiTools\Rest\OptionsListener" => "Laminas\ApiTools\Rest\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Rpc\OptionsListener" => "Laminas\ApiTools\Rpc\Factory\OptionsListenerFactory"
      "Laminas\ApiTools\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\Factory\AcceptListenerFactory"
      "Laminas\ApiTools\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\Factory\ContentTypeListenerFactory"
      "Laminas\ApiTools\Versioning\VersionListener" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Api\V1\Rest\ContactResource\MeListener" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "LmcCors\Mvc\CorsRequestListener" => "LmcCors\Factory\CorsRequestListenerFactory"
      "LmcCors\Options\CorsOptions" => "LmcCors\Factory\CorsOptionsFactory"
      "LmcCors\Service\CorsService" => "LmcCors\Factory\CorsServiceFactory"
      "AssetManager\Service\AssetManager" => "AssetManager\Service\AssetManagerServiceFactory"
      "AssetManager\Service\AssetFilterManager" => "AssetManager\Service\AssetFilterManagerServiceFactory"
      "AssetManager\Service\AssetCacheManager" => "AssetManager\Service\AssetCacheManagerServiceFactory"
      "AssetManager\Resolver\AggregateResolver" => "AssetManager\Service\AggregateResolverServiceFactory"
      "AssetManager\Resolver\MapResolver" => "AssetManager\Service\MapResolverServiceFactory"
      "AssetManager\Resolver\PathStackResolver" => "AssetManager\Service\PathStackResolverServiceFactory"
      "AssetManager\Resolver\PrioritizedPathsResolver" => "AssetManager\Service\PrioritizedPathsResolverServiceFactory"
      "AssetManager\Resolver\CollectionResolver" => "AssetManager\Service\CollectionResolverServiceFactory"
      "AssetManager\Resolver\ConcatResolver" => "AssetManager\Service\ConcatResolverServiceFactory"
      "AssetManager\Resolver\AliasPathStackResolver" => "AssetManager\Service\AliasPathStackResolverServiceFactory"
      "Twig\Environment" => "ZfcTwig\Twig\EnvironmentFactory"
      "Twig\Loader\ChainLoader" => "ZfcTwig\Twig\ChainLoaderFactory"
      "ZfcTwig\Twig\Extension" => "ZfcTwig\Twig\ExtensionFactory"
      "ZfcTwig\Twig\MapLoader" => "ZfcTwig\Twig\MapLoaderFactory"
      "ZfcTwig\Twig\StackLoader" => "ZfcTwig\Twig\StackLoaderFactory"
      "ZfcTwig\View\TwigRenderer" => "ZfcTwig\View\TwigRendererFactory"
      "ZfcTwig\View\TwigResolver" => "ZfcTwig\View\TwigResolverFactory"
      "ZfcTwig\View\HelperPluginManager" => "ZfcTwig\View\HelperPluginManagerFactory"
      "ZfcTwig\View\TwigStrategy" => "ZfcTwig\View\TwigStrategyFactory"
      "ZfcTwig\ModuleOptions" => "ZfcTwig\ModuleOptionsFactory"
      "BjyAuthorize\Cache" => "BjyAuthorize\Service\CacheFactory"
      "BjyAuthorize\CacheKeyGenerator" => "BjyAuthorize\Service\CacheKeyGeneratorFactory"
      "BjyAuthorize\Config" => "Jield\Authorize\Factory\ConfigServiceFactory"
      "BjyAuthorize\Guards" => "BjyAuthorize\Service\GuardsServiceFactory"
      "BjyAuthorize\RoleProviders" => "BjyAuthorize\Service\RoleProvidersServiceFactory"
      "BjyAuthorize\ResourceProviders" => "BjyAuthorize\Service\ResourceProvidersServiceFactory"
      "BjyAuthorize\RuleProviders" => "BjyAuthorize\Service\RuleProvidersServiceFactory"
      "BjyAuthorize\Service\RoleDbTableGateway" => "BjyAuthorize\Service\UserRoleServiceFactory"
      "BjyAuthorize\Collector\RoleCollector" => "BjyAuthorize\Service\RoleCollectorServiceFactory"
      "BjyAuthorize\Guard\Controller" => "BjyAuthorize\Service\ControllerGuardServiceFactory"
      "BjyAuthorize\Guard\Route" => "BjyAuthorize\Service\RouteGuardServiceFactory"
      "BjyAuthorize\Provider\Identity\AuthenticationIdentityProvider" => "BjyAuthorize\Service\AuthenticationIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\LmcUserLaminasDb" => "BjyAuthorize\Service\LmcUserLaminasDbIdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Identity\ProviderInterface" => "BjyAuthorize\Service\IdentityProviderServiceFactory"
      "BjyAuthorize\Provider\Resource\Config" => "BjyAuthorize\Service\ConfigResourceProviderServiceFactory"
      "BjyAuthorize\Provider\Role\Config" => "BjyAuthorize\Service\ConfigRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\LaminasDb" => "BjyAuthorize\Service\LaminasDbRoleProviderServiceFactory"
      "BjyAuthorize\Provider\Role\ObjectRepositoryProvider" => "BjyAuthorize\Service\ObjectRepositoryRoleProviderFactory"
      "BjyAuthorize\Provider\Rule\Config" => "BjyAuthorize\Service\ConfigRuleProviderServiceFactory"
      "BjyAuthorize\Service\Authorize" => "BjyAuthorize\Service\AuthorizeFactory"
      "BjyAuthorize\View\UnauthorizedStrategy" => "BjyAuthorize\Service\UnauthorizedStrategyServiceFactory"
      "Jield\Authorize\View\UnauthorizedStrategy" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Jield\Authorize\Service\AuthorizeService" => "Jield\Authorize\Factory\AuthorizeServiceFactory"
      "Jield\Authorize\Service\AssertionService" => "Jield\Authorize\Factory\AssertionServiceFactory"
      "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider" => "Jield\Authorize\Factory\AuthenticationIdentityProviderFactory"
      "Jield\Authorize\Rule\RulesWithAssertion" => "Jield\Authorize\Factory\RuleWithAssertionFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "doctrine.cache.application_cache" => "Application\Factory\StorageCacheFactory"
      "Laminas\Cache\Storage\Adapter\Redis" => "Application\Factory\LaminasCacheFactory"
      "Application\Event\InjectAclInNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\SetTitle" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Application\Event\BlockInactiveContact" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Event\RegisterPageview" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\I18n\Translator\TranslatorInterface" => "Application\Factory\TranslatorServiceFactory"
      "Application\Service\FormService" => "Application\Factory\FormServiceFactory"
      "Application\Options\ModuleOptions" => "Application\Factory\ModuleOptionsFactory"
      "Application\Authentication\Storage\AuthenticationStorage" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Authentication\AuthenticationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Session\SaveHandler\DoctrineGateway" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Application\Twig\DatabaseTwigLoader" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "cms_navigation" => "Content\Navigation\Factory\ContentNavigationFactory"
      "Content\Service\ContentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\NodeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\VimeoService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\ArticleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Service\RouteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Event\InitRoutes" => "Application\Factory\InvokableFactory"
      "Content\InputFilter\HandlerFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\RouteFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\SegmentFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\InputFilter\TopicFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Options\ModuleOptions" => "Content\Factory\ModuleOptionsFactory"
      "Content\Navigation\Service\ContentNavigationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ContentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\HandlerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\NodeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\ParamLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\RouteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\SegmentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Navigation\Invokable\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Content\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Content\Acl\Assertion\Node" => "Application\Factory\InvokableFactory"
      "General\Options\ModuleOptions" => "General\Factory\ModuleOptionsFactory"
      "General\Options\EmailOptions" => "General\Factory\EmailOptionsFactory"
      "General\InputFilter\ChallengeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\Challenge\TypeFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\CountryFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\GenderFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\LanguageFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\ExchangeRateFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\TitleFilter" => "Application\Factory\InputFilterFactory"
      "General\InputFilter\WebInfoFilter" => "Application\Factory\InputFilterFactory"
      "General\Service\GeneralService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\CountryService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\Service\EmailService" => "Application\Factory\InvokableFactory"
      "General\Search\Service\CountrySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Laminas\Mail\Transport\Smtp" => "General\Factory\SmtpTransportFactory"
      "Laminas\Mail\Transport\Sendmail" => "General\Factory\SendmailTransportFactory"
      "Mailjet\Client" => "General\Factory\MailjetClientFactory"
      "General\Navigation\Invokable\ChallengeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ChallengeTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\ContentTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\EmailMessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\Country\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\LanguageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\CurrencyLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\PasswordLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\GenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\TitleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\VatTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "General\Navigation\Invokable\WebInfoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Cluster\Command\UpdateProject" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Command\GenerateProjectJson" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Options\ModuleOptions" => "Cluster\Factory\ModuleOptionsFactory"
      "Cluster\Acl\Assertion\ClusterAssertion" => "Application\Factory\InvokableFactory"
      "Cluster\Form\ClusterForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\InputFilter\ClusterFilter" => "Application\Factory\InputFilterFactory"
      "Cluster\Service\ClusterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\Navigation\Invokable\ClusterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Service\NewsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\BlogService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Service\MagazineService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\InputFilter\Blog\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\Blog\TagFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\News\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "News\InputFilter\MagazineFilter" => "Application\Factory\InputFilterFactory"
      "News\Acl\Assertion\Magazine" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Magazine\Article" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\Blog" => "Application\Factory\InvokableFactory"
      "News\Acl\Assertion\News" => "Application\Factory\InvokableFactory"
      "News\Search\Service\NewsSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Search\Service\BlogSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\Navigation\Invokable\BlogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\TagLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Blog\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\NewsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\News\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\MagazineLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "News\Navigation\Invokable\Magazine\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Command\ResetAccess" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Provider\ContactProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Contact\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\FacebookLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\OptInLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\AddressLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\DndLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\NoteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\PhoneLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Selection\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Navigation\Invokable\Office\LeaveLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Contact\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\SelectionContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\AddressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Service\Office\ContactService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\ContactForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\InputFilter\AddressFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\PhoneFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\FacebookFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\DndFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\OptInFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Selection\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\ContactFilter" => "Application\Factory\InputFilterFactory"
      "Contact\InputFilter\Office\LeaveFilter" => "Application\Factory\InputFilterFactory"
      "Contact\Search\Service\ContactSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Search\Service\ProfileSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Acl\Assertion\Address" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Profile" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Facebook" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Note" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Phone" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Selection" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\ContactAssertion" => "Application\Factory\InvokableFactory"
      "Contact\Acl\Assertion\Office\LeaveAssertion" => "Application\Factory\InvokableFactory"
      "Quality\Service\QualityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\Navigation\Invokable\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\SourceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Action\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\PhaseLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\YearLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\KpiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\GroupLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\Navigation\Invokable\Kpi\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Quality\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\PhaseFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\YearFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\KpiFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\TargetFilter" => "Application\Factory\InputFilterFactory"
      "Quality\InputFilter\Kpi\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\Provider\ProjectProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Provider\Version\VersionProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Acl\Assertion\ChangeRequest\CostChange" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Country" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\ChangeRequest\Process" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Description\Description" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Document\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Tool\Session" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Idea" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Image" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Partner" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Video" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Meeting\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Message\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Idea\Status\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Poster\Poster" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Item" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WorkpackageDescription" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Report" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\WindowAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Report\Window\ProjectAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Result\Result" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Version\Version" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable\Document" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Task" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Deliverable" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Workpackage\Workpackage" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResultAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\LinkAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Achievement\ExploitableResult\DocumentAssertion" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Action" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Pca" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Help" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\HelpFaq" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Invite" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Log" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Project" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Rationale" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Roadmap" => "Application\Factory\InvokableFactory"
      "Project\Acl\Assertion\Calendar\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Project\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Project\Service\ProjectService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\KeywordService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AchievementService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Achievement\ExploitableResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\VersionDocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Report\WindowService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DocumentService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\WorkpackageService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ContractService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\DescriptionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\IdeaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\Idea\Tool\SessionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ResultService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\HelpService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\InviteService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ChangeRequestService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\ActionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\AwardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Service\EventService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\ProjectForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\Deliverable\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DeliverableFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\TaskFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Workpackage\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AchievementFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Achievement\ExploitableResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ProjectFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Action\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ActionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\AwardFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Award\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CostChangeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\ChangeRequest\ProcessFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Document\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Description\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Event\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\ResultFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Result\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\ReportFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Report\WorkpackageDescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\RationaleFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\InputFilter\Version\VersionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\IdeaFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\ToolFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\StatusFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Description\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\Tool\SessionFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\Idea\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\FeeFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\LogFilter" => "Application\Factory\InputFilterFactory"
      "Project\InputFilter\HelpFilter" => "Application\Factory\InputFilterFactory"
      "Project\Options\ModuleOptions" => "Project\Factory\ModuleOptionsFactory"
      "Project\Navigation\Service\HelpNavigationService" => "Project\Navigation\Factory\HelpNavigationServiceFactory"
      "Project\Navigation\Invokable\AchievementLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinkLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\LinksLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Link\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\DocumentsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Achievement\ExploitableResult\Document\CreateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ActionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\AwardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Award\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CostChangeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ChangeRequest\ProcessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\RationaleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Document\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventTypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ContractLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Contract\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\EventLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\FeeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\HelpFaqLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\IdeaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\ToolLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Tool\SessionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\DescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Description\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PartnerLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MessageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\StatusLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Meeting\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\VideoLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Idea\Poster\PosterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\InviteLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\ItemLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WorkpackageDescriptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\ResultLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\Type\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Result\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Version\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\WorkpackageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\TaskLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\DeliverableLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Workpackage\Deliverable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Navigation\Invokable\Project\CalendarReviewLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Project\Search\Service\AchievementSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\Achievement\ExploitableResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\IdeaSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\DescriptionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ProjectSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\VersionDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\WorkpackageDocumentSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ResultSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Search\Service\ActionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Acl\Assertion\FeedbackAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\EvaluationAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReportAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\Acl\Assertion\ReviewerAssertion" => "Application\Factory\InvokableFactory"
      "Evaluation\InputFilter\Report\Criterion\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TopicFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\InputFilter\Report\Criterion\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Evaluation\Service\EvaluationReportService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\EvaluationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewRosterService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Service\ReviewerService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\Navigation\Invokable\ReportLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\CriterionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\WindowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\TopicLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Report\Criterion\VersionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\Reviewer\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluateProjectLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\EvaluationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Navigation\Invokable\FeedbackLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Evaluation\Options\ModuleOptions" => "Evaluation\Options\Factory\ModuleOptionsFactory"
      "Press\Service\PressService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Search\Service\PressSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Press\Acl\Assertion\Article" => "Application\Factory\InvokableFactory"
      "Press\Navigation\Invokable\ArticleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Press\Navigation\Invokable\BureauLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Service\ProgramService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\Service\CallService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Program\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\ProgramFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\FunderFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CallFilter" => "Application\Factory\InputFilterFactory"
      "Program\InputFilter\Call\CountryFilter" => "Application\Factory\InputFilterFactory"
      "Program\Options\ModuleOptions" => "Program\Factory\ModuleOptionsFactory"
      "Program\Acl\Assertion\Doa" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Funder" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Nda" => "Application\Factory\InvokableFactory"
      "Program\Acl\Assertion\Call\Country" => "Application\Factory\InvokableFactory"
      "Program\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Program\Navigation\Invokable\CallLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\CountryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\FunderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\NdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\ProgramLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Program\Navigation\Invokable\UploadNdaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Search\Command\UpdateIndex" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Search\Service\ConsoleService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\AdminService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\StatisticsService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\QueueService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\ApiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Service\OAuth2Service" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\InputFilter\AccessFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Admin\Navigation\Invokable\AccessLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ClientLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\OAuth2\ScopeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\EntityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\RoleLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Permit\SetterLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\Api\LogLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Admin\Navigation\Invokable\QueueLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Provider\AffiliationProvider" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\AffiliationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\QuestionnaireService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\DoaService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\Service\LoiService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Affiliation\InputFilter\AffiliationFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DescriptionFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\InputFilter\DoaFilter" => "Application\Factory\InputFilterFactory"
      "Affiliation\Options\ModuleOptions" => "Affiliation\Factory\ModuleOptionsFactory"
      "Affiliation\Acl\Assertion\AffiliationAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\LoiAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Acl\Assertion\QuestionnaireAssertion" => "Application\Factory\InvokableFactory"
      "Affiliation\Navigation\Invokable\AffiliationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\LoiLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\CategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Affiliation\Navigation\Invokable\Questionnaire\QuestionnaireLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Command\Cleanup" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Options\ModuleOptions" => "Organisation\Factory\ModuleOptionsFactory"
      "Organisation\Form\OrganisationForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\CityForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\AdvisoryBoard\SolutionForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\UpdateForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Form\FinancialForm" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\OrganisationService" => "Application\Factory\InvokableFactory"
      "Organisation\Service\UpdateService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\SelectionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\BoardService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\CityService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\AdvisoryBoard\SolutionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Service\ParentService" => "Application\Factory\InvokableFactory"
      "Organisation\InputFilter\FinancialFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\BoardFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\OrganisationFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\SelectionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\ParentEntityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\Parent\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\CityFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\InputFilter\AdvisoryBoard\SolutionFilter" => "Application\Factory\InputFilterFactory"
      "Organisation\Acl\Assertion\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\NoteAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\ParentAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\UpdateAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\FinancialAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\DoaAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\TypeAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\Parent\OrganisationAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\CityAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Acl\Assertion\AdvisoryBoard\SolutionAssertion" => "Application\Factory\InvokableFactory"
      "Organisation\Search\Service\OrganisationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Organisation\Navigation\Invokable\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\SelectionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\BoardLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\ParentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\UpdateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\OrganisationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\DoaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\Parent\FinancialLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\CityLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Organisation\Navigation\Invokable\AdvisoryBoard\SolutionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Service\PublicationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\InputFilter\PublicationFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\CategoryFilter" => "Application\Factory\InputFilterFactory"
      "Publication\InputFilter\TypeFilter" => "Application\Factory\InputFilterFactory"
      "Publication\Search\Service\PublicationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Publication\Acl\Assertion\Publication" => "Application\Factory\InvokableFactory"
      "Publication\Event\UpdateNavigation" => "Application\Factory\InvokableFactory"
      "Publication\Navigation\Invokable\PublicationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeCategoryLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Publication\Navigation\Invokable\TypeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Command\DailyUpdate" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Command\Sync" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\TransactionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Service\InvoiceService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Options\ModuleOptions" => "Invoice\Factory\ModuleOptionsFactory"
      "Invoice\Search\Service\InvoiceSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Invoice\Acl\Assertion\Invoice" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Journal" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Method" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Pdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Reminder" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\ReminderPdf" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Row" => "Application\Factory\InvokableFactory"
      "Invoice\Acl\Assertion\Transaction" => "Application\Factory\InvokableFactory"
      "Invoice\Navigation\Invokable\InvoiceLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\JournalLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\TransactionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\ReminderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\RowLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Invoice\Navigation\Invokable\VatDimensionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Deeplink\Service\DeeplinkService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\InputFilter\TargetFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Deeplink\Navigation\Invokable\TargetLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Command\CancelPaymentPending" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Command\UpdateRegistrations" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Navigation\Invokable\BoothLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BoothSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\DeskCostsLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\CouponLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionSpecLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\ExhibitionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\RegistrationDeskScanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingQuotaLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionCostLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingOptionLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\MeetingFloorplanLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\BadgeImageLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Navigation\Invokable\TicketLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Event\Service\BadgeService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\MeetingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\BoothService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\RegistrationService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionFloorplanService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Service\ExhibitionSpecService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\InputFilter\Badge\AttachmentFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\DeskCostsFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\MeetingFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\QuotaFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Meeting\OptionCostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\CostFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\ExhibitionFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Exhibition\SpecFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\Booth\BoothFilter" => "Application\Factory\InputFilterFactory"
      "Event\InputFilter\RegistrationFilter" => "Application\Factory\InputFilterFactory"
      "Event\Options\ModuleOptions" => "Event\Factory\ModuleOptionsFactory"
      "Event\Options\CometChatApiOptions" => "Event\Factory\CometChatApiOptionsFactory"
      "Event\Search\Service\RegistrationSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Event\Acl\Assertion\Badge" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Booth" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\BoothSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Exhibition" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\ExhibitionSpec" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Meeting" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\MeetingFloorplan" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Registration" => "Application\Factory\InvokableFactory"
      "Event\Acl\Assertion\Ticket" => "Application\Factory\InvokableFactory"
      "Calendar\Service\CalendarService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Options\ModuleOptions" => "Calendar\Factory\ModuleOptionsFactory"
      "Calendar\Acl\Assertion\Calendar" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Contact" => "Application\Factory\InvokableFactory"
      "Calendar\Acl\Assertion\Document" => "Application\Factory\InvokableFactory"
      "Calendar\Search\Service\CalendarSearchService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Calendar\Navigation\Invokable\CalendarLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Calendar\Navigation\Invokable\DocumentLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Command\FlushQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Command\SendQueue" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Service\MailingService" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\MailingFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\SenderFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\InputFilter\TemplateFilter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Mailing\Navigation\Invokable\MailingLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\ContactLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\SenderLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "Mailing\Navigation\Invokable\TemplateLabel" => "General\Navigation\Factory\NavigationInvokableFactory"
      "LaminasGoogleAnalytics\Analytics\Tracker" => "LaminasGoogleAnalytics\Service\TrackerFactory"
      "LaminasGoogleAnalytics\Service\ScriptFactory" => "LaminasGoogleAnalytics\Service\ScriptFactory"
      "Accounting\Adapter\TwinfieldAdapter" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Accounting\Options\ModuleOptions" => "Accounting\Factory\ModuleOptionsFactory"
      "ErrorHeroModule\Listener\Mvc" => "ErrorHeroModule\Listener\MvcFactory"
      "ErrorHeroModule\Handler\Logging" => "ErrorHeroModule\Handler\LoggingFactory"
      "SlmQueue\Job\JobPluginManager" => "SlmQueue\Factory\JobPluginManagerFactory"
      "SlmQueue\Strategy\StrategyPluginManager" => "SlmQueue\Factory\StrategyPluginManagerFactory"
      "SlmQueue\Queue\QueuePluginManager" => "SlmQueue\Factory\QueuePluginManagerFactory"
      "SlmQueue\Worker\WorkerPluginManager" => "SlmQueue\Factory\WorkerPluginManagerFactory"
      "SlmQueue\Command\StartWorkerCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
      "SlmQueueDoctrine\Command\RecoverJobsCommand" => "Laminas\ServiceManager\AbstractFactory\ReflectionBasedAbstractFactory"
    ]
    "aliases" => array:81 [
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "navigation" => "Laminas\Navigation\Navigation"
      "Zend\Navigation\Navigation" => "Laminas\Navigation\Navigation"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
      "ZF\Apigility\MvcAuth\UnauthenticatedListener" => "Laminas\ApiTools\MvcAuth\UnauthenticatedListener"
      "ZF\Apigility\MvcAuth\UnauthorizedListener" => "Laminas\ApiTools\MvcAuth\UnauthorizedListener"
      "ZF\Apigility\Documentation\ApiFactory" => "Laminas\ApiTools\Documentation\ApiFactory"
      "ZF\Apigility\Documentation\Swagger\SwaggerViewStrategy" => "Laminas\ApiTools\Documentation\Swagger\SwaggerViewStrategy"
      "Laminas\ApiTools\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "Laminas\ApiTools\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "Laminas\ApiTools\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "Laminas\ApiTools\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\ApiProblem\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\ApiProblemListener"
      "ZF\ApiProblem\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\RenderErrorListener"
      "ZF\ApiProblem\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\ApiProblemRenderer"
      "ZF\ApiProblem\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\ApiProblemStrategy"
      "ZF\ApiProblem\Listener\ApiProblemListener" => "Laminas\ApiTools\ApiProblem\Listener\ApiProblemListener"
      "ZF\ApiProblem\Listener\RenderErrorListener" => "Laminas\ApiTools\ApiProblem\Listener\RenderErrorListener"
      "ZF\ApiProblem\Listener\SendApiProblemResponseListener" => "Laminas\ApiTools\ApiProblem\Listener\SendApiProblemResponseListener"
      "ZF\ApiProblem\View\ApiProblemRenderer" => "Laminas\ApiTools\ApiProblem\View\ApiProblemRenderer"
      "ZF\ApiProblem\View\ApiProblemStrategy" => "Laminas\ApiTools\ApiProblem\View\ApiProblemStrategy"
      "ZF\Configuration\ConfigResource" => "Laminas\ApiTools\Configuration\ConfigResource"
      "ZF\Configuration\ConfigResourceFactory" => "Laminas\ApiTools\Configuration\ConfigResourceFactory"
      "ZF\Configuration\ConfigWriter" => "Laminas\ApiTools\Configuration\ConfigWriter"
      "ZF\Configuration\ModuleUtils" => "Laminas\ApiTools\Configuration\ModuleUtils"
      "Laminas\ApiTools\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Provider\UserId" => "Laminas\ApiTools\OAuth2\Provider\UserId"
      "ZF\OAuth2\Adapter\PdoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
      "ZF\OAuth2\Adapter\MongoAdapter" => "Laminas\ApiTools\OAuth2\Adapter\MongoAdapter"
      "ZF\OAuth2\Provider\UserId\AuthenticationService" => "Laminas\ApiTools\OAuth2\Provider\UserId\AuthenticationService"
      "ZF\OAuth2\Service\OAuth2Server" => "Laminas\ApiTools\OAuth2\Service\OAuth2Server"
      "authentication" => "Laminas\ApiTools\MvcAuth\Authentication"
      "authorization" => "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface"
      "Laminas\ApiTools\MvcAuth\Authorization\AuthorizationInterface" => "Laminas\ApiTools\MvcAuth\Authorization\AclAuthorization"
      "ZF\Hal\Extractor\LinkExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkExtractor"
      "ZF\Hal\Extractor\LinkCollectionExtractor" => "Laminas\ApiTools\Hal\Extractor\LinkCollectionExtractor"
      "ZF\Hal\HalConfig" => "Laminas\ApiTools\Hal\HalConfig"
      "ZF\Hal\JsonRenderer" => "Laminas\ApiTools\Hal\JsonRenderer"
      "ZF\Hal\JsonStrategy" => "Laminas\ApiTools\Hal\JsonStrategy"
      "ZF\Hal\Link\LinkUrlBuilder" => "Laminas\ApiTools\Hal\Link\LinkUrlBuilder"
      "ZF\Hal\MetadataMap" => "Laminas\ApiTools\Hal\MetadataMap"
      "ZF\Hal\RendererOptions" => "Laminas\ApiTools\Hal\RendererOptions"
      "ZF\Versioning\AcceptListener" => "Laminas\ApiTools\Versioning\AcceptListener"
      "ZF\Versioning\ContentTypeListener" => "Laminas\ApiTools\Versioning\ContentTypeListener"
      "ZF\Versioning\VersionListener" => "Laminas\ApiTools\Versioning\VersionListener"
      "mime_resolver" => "AssetManager\Service\MimeResolver"
      "AssetManager\Service\AggregateResolver" => "AssetManager\Resolver\AggregateResolver"
      "ZfcTwigExtension" => "ZfcTwig\Twig\Extension"
      "ZfcTwigLoaderChain" => "Twig\Loader\ChainLoader"
      "ZfcTwigLoaderTemplateMap" => "ZfcTwig\Twig\MapLoader"
      "ZfcTwigLoaderTemplatePathStack" => "ZfcTwig\Twig\StackLoader"
      "ZfcTwigRenderer" => "ZfcTwig\View\TwigRenderer"
      "ZfcTwigResolver" => "ZfcTwig\View\TwigResolver"
      "ZfcTwigViewHelperManager" => "ZfcTwig\View\HelperPluginManager"
      "ZfcTwigViewStrategy" => "ZfcTwig\View\TwigStrategy"
      "bjyauthorize_zend_db_adapter" => "Laminas\Db\Adapter\Adapter"
      "BjyAuthorize\Service\Authorize" => "Jield\Authorize\Service\AuthorizeService"
      "BjyAuthorize\Cache" => "Laminas\Cache\Storage\Adapter\Redis"
      "google-analytics" => "LaminasGoogleAnalytics\Analytics\Tracker"
      "google-analytics-universal" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "google-analytics-ga" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "delegators" => array:2 [
      "ViewHelperManager" => array:1 [ …1]
      "Laminas\ApiTools\MvcAuth\Authentication\DefaultAuthenticationListener" => array:1 [ …1]
    ]
    "invokables" => array:44 [
      "Laminas\ApiTools\Rest\RestParametersListener" => "Laminas\ApiTools\Rest\Listener\RestParametersListener"
      "AssetManager\Service\MimeResolver" => "AssetManager\Service\MimeResolver"
      0 => "BjyAuthorize\View\RedirectionStrategy"
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
      "Content\InputFilter\ArticleFilter" => "Content\InputFilter\ArticleFilter"
      "Content\InputFilter\ContentFilter" => "Content\InputFilter\ContentFilter"
      "Content\InputFilter\ContentParamFilter" => "Content\InputFilter\ContentParamFilter"
      "Content\InputFilter\NodeFilter" => "Content\InputFilter\NodeFilter"
      "Content\InputFilter\ParamFilter" => "Content\InputFilter\ParamFilter"
      1 => "General\InputFilter\PasswordFilter"
      2 => "Cluster\Provider\ClusterProvider"
      3 => "News\InputFilter\NewsFilter"
      4 => "News\InputFilter\BlogFilter"
      5 => "News\InputFilter\Blog\MessageFilter"
      6 => "News\InputFilter\Magazine\ArticleFilter"
      7 => "Press\InputFilter\ArticleFilter"
      8 => "Press\InputFilter\BureauFilter"
      9 => "Program\InputFilter\Call\CallFilter"
      10 => "Program\InputFilter\Call\CountryFilter"
      11 => "Program\InputFilter\DoaFilter"
      12 => "Program\InputFilter\FunderFilter"
      13 => "Admin\InputFilter\Permit\RoleFilter"
      14 => "Organisation\InputFilter\NoteFilter"
      15 => "Invoice\InputFilter\InvoiceFilter"
      16 => "Invoice\InputFilter\RowFilter"
      "Calendar\InputFilter\CalendarFilter" => "Calendar\InputFilter\CalendarFilter"
      "Calendar\InputFilter\DocumentFilter" => "Calendar\InputFilter\DocumentFilter"
      "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs" => "LaminasGoogleAnalytics\View\Helper\Script\Analyticsjs"
      "LaminasGoogleAnalytics\View\Helper\Script\Gajs" => "LaminasGoogleAnalytics\View\Helper\Script\Gajs"
    ]
    "initializers" => array:1 [
      0 => "BjyAuthorize\Service\AuthorizeAwareServiceInitializer"
    ]
    "shared" => array:1 [
      "Contact\Service\ContactService" => false
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:15 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
      "cluster:update-project" => "Cluster\Command\UpdateProject"
      "cluster:generate-project-json" => "Cluster\Command\GenerateProjectJson"
      "contact:cleanup" => "Contact\Command\Cleanup"
      "contact:reset-access" => "Contact\Command\ResetAccess"
      "search:update-index" => "Search\Command\UpdateIndex"
      "organisation:cleanup" => "Organisation\Command\Cleanup"
      "invoice:sync" => "Invoice\Command\Sync"
      "invoice:daily-update" => "Invoice\Command\DailyUpdate"
      "event:update-registrations" => "Event\Command\UpdateRegistrations"
      "event:cancel-payment-pending" => "Event\Command\CancelPaymentPending"
      "mailing:send-queue" => "Mailing\Command\SendQueue"
      "mailing:flush-queue" => "Mailing\Command\FlushQueue"
      "slm-queue:start" => "SlmQueue\Command\StartWorkerCommand"
      "slm-queue:doctrine:recover" => "SlmQueueDoctrine\Command\RecoverJobsCommand"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:28 [
      "api-tools" => array:4 [ …4]
      "oauth" => array:4 [ …4]
      "api" => array:4 [ …4]
      "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
      "doctrine_orm_module_yuml" => array:2 [ …2]
      "zfcadmin" => array:5 [ …5]
      "home" => array:3 [ …3]
      "my" => array:3 [ …3]
      "redirect" => array:5 [ …5]
      "image" => array:4 [ …4]
      "country" => array:5 [ …5]
      "impact-stream" => array:5 [ …5]
      "challenge" => array:4 [ …4]
      "email" => array:5 [ …5]
      "community" => array:5 [ …5]
      "magazine" => array:4 [ …4]
      "annual-report" => array:4 [ …4]
      "json" => array:4 [ …4]
      "assets" => array:4 [ …4]
      "project" => array:5 [ …5]
      "press" => array:4 [ …4]
      "search" => array:3 [ …3]
      "oauth2" => array:4 [ …4]
      "user" => array:5 [ …5]
      "organisation" => array:5 [ …5]
      "publication" => array:5 [ …5]
      "deeplink" => array:3 [ …3]
      "error-preview" => array:2 [ …2]
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:504 [
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "agacceptheaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "agcontenttypeheaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "agservicepath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "agstatuscodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "agtransformdescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "agTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "ZF\Apigility\Documentation\View\AgAcceptHeaders" => "Laminas\ApiTools\Documentation\View\AgAcceptHeaders"
      "ZF\Apigility\Documentation\View\AgContentTypeHeaders" => "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders"
      "ZF\Apigility\Documentation\View\AgServicePath" => "Laminas\ApiTools\Documentation\View\AgServicePath"
      "ZF\Apigility\Documentation\View\AgStatusCodes" => "Laminas\ApiTools\Documentation\View\AgStatusCodes"
      "ZF\Apigility\Documentation\View\AgTransformDescription" => "Laminas\ApiTools\Documentation\View\AgTransformDescription"
      "asset" => "AssetManager\View\Helper\Asset"
      "nodeLink" => "Content\View\Helper\NodeLink"
      "paramLink" => "Content\View\Helper\ParamLink"
      "handlerLink" => "Content\View\Helper\HandlerLink"
      "segmentLink" => "Content\View\Helper\SegmentLink"
      "templateLink" => "Content\View\Helper\TemplateLink"
      "contentLink" => "Content\View\Helper\ContentLink"
      "routeLink" => "Content\View\Helper\RouteLink"
      "topicLink" => "Content\View\Helper\TopicLink"
      "articleLink" => "Content\View\Helper\ArticleLink"
      "nodeTableRow" => "Content\View\Helper\NodeTableRow"
      "imageLink" => "Content\View\Helper\ImageLink"
      "image" => "Content\View\Helper\Image"
      "videoLink" => "Content\View\Helper\VideoLink"
      "video" => "Content\View\Helper\Video"
      "paginationLink" => "Content\View\Helper\PaginationLink"
      "imageHandler" => "Content\View\Handler\ImageHandler"
      "contentHandler" => "Content\View\Handler\ContentHandler"
      "buildNavigation" => "Content\View\Helper\BuildNavigation"
      "challengeHandler" => "General\View\Handler\ChallengeHandler"
      "challengeIcon" => "General\View\Helper\Challenge\ChallengeIcon"
      "challengeImage" => "General\View\Helper\Challenge\ChallengeImage"
      "challengeIdeaPosterImage" => "General\View\Helper\Challenge\Idea\Poster\Image"
      "challengeIdeaPosterIcon" => "General\View\Helper\Challenge\Idea\Poster\Icon"
      "challengeTypeLink" => "General\View\Helper\Challenge\TypeLink"
      "countryMap" => "General\View\Helper\Country\CountryMap"
      "countryFlag" => "General\View\Helper\Country\CountryFlag"
      "countryLink" => "General\View\Helper\Country\CountryLink"
      "countryVideoLink" => "General\View\Helper\Country\VideoLink"
      "languageLink" => "General\View\Helper\LanguageLink"
      "currencyLink" => "General\View\Helper\CurrencyLink"
      "exchangeRateLink" => "General\View\Helper\ExchangeRateLink"
      "passwordLink" => "General\View\Helper\PasswordLink"
      "emailMessageLink" => "General\View\Helper\EmailMessageLink"
      "generalLogLink" => "General\View\Helper\LogLink"
      "vatLink" => "General\View\Helper\VatLink"
      "genderLink" => "General\View\Helper\GenderLink"
      "titleLink" => "General\View\Helper\TitleLink"
      "vatTypeLink" => "General\View\Helper\VatTypeLink"
      "challengeLink" => "General\View\Helper\Challenge\ChallengeLink"
      "webInfoLink" => "General\View\Helper\WebInfoLink"
      "contentTypeLink" => "General\View\Helper\ContentTypeLink"
      "contentTypeIcon" => "General\View\Helper\ContentTypeIcon"
      "countryselect" => "General\Form\View\Helper\CountrySelect"
      "clusterLink" => "Cluster\View\Helper\ClusterLink"
      "clusterLogo" => "Cluster\View\Helper\Cluster\Logo"
      "blogLink" => "News\View\Helper\BlogLink"
      "blogMessageLink" => "News\View\Helper\Blog\MessageLink"
      "blogTagLink" => "News\View\Helper\Blog\TagLink"
      "blogCategoryLink" => "News\View\Helper\Blog\CategoryLink"
      "newsLink" => "News\View\Helper\NewsLink"
      "newsCategoryLink" => "News\View\Helper\News\CategoryLink"
      "magazineLink" => "News\View\Helper\MagazineLink"
      "magazineArticleLink" => "News\View\Helper\Magazine\ArticleLink"
      "blogselect" => "News\Form\View\Helper\BlogSelect"
      "contactLink" => "Contact\View\Helper\ContactLink"
      "officeContactLink" => "Contact\View\Helper\Office\ContactLink"
      "leaveLink" => "Contact\View\Helper\Office\LeaveLink"
      "dndLink" => "Contact\View\Helper\DndLink"
      "profileLink" => "Contact\View\Helper\ProfileLink"
      "selectionLink" => "Contact\View\Helper\SelectionLink"
      "selectionTypeLink" => "Contact\View\Helper\Selection\TypeLink"
      "facebookLink" => "Contact\View\Helper\FacebookLink"
      "optInLink" => "Contact\View\Helper\OptInLink"
      "addressLink" => "Contact\View\Helper\AddressLink"
      "noteLink" => "Contact\View\Helper\NoteLink"
      "phoneLink" => "Contact\View\Helper\PhoneLink"
      "contactPhoto" => "Contact\View\Helper\ContactPhoto"
      "contactformelement" => "Contact\Form\View\Helper\ContactFormElement"
      "selectionformelement" => "Contact\Form\View\Helper\SelectionFormElement"
      "qualityActionLink" => "Quality\View\Helper\ActionLink"
      "qualityProcessLink" => "Quality\View\Helper\ProcessLink"
      "qualityStatusLink" => "Quality\View\Helper\StatusLink"
      "qualityStatusBadge" => "Quality\View\Helper\StatusBadge"
      "qualityPhaseLink" => "Quality\View\Helper\PhaseLink"
      "qualityYearLink" => "Quality\View\Helper\YearLink"
      "qualityTargetLink" => "Quality\View\Helper\TargetLink"
      "qualityKpiLink" => "Quality\View\Helper\KpiLink"
      "qualityKpiTargetLink" => "Quality\View\Helper\Kpi\TargetLink"
      "qualityKpiGroupLink" => "Quality\View\Helper\Kpi\GroupLink"
      "qualityKpiResultLink" => "Quality\View\Helper\Kpi\ResultLink"
      "qualityKpiResultMatrix" => "Quality\View\Helper\Kpi\Result\Matrix"
      "qualityActionSourceLink" => "Quality\View\Helper\Action\SourceLink"
      "qualityActionGroupLink" => "Quality\View\Helper\Action\GroupLink"
      "qualityActionResultMatrix" => "Quality\View\Helper\Action\Result\Matrix"
      "projectLogo" => "Project\View\Helper\Project\ProjectLogo"
      "projectQuickstart" => "Project\View\Helper\Project\Quickstart"
      "projectStatusIcon" => "Project\View\Helper\Project\StatusIcon"
      "projectDates" => "Project\View\Helper\Project\ProjectDates"
      "projectInviteLink" => "Project\View\Helper\Project\InviteLink"
      "projectSelectionLink" => "Project\View\Helper\SelectionLink"
      "ideaImage" => "Project\View\Helper\Idea\IdeaImage"
      "toolSessionLink" => "Project\View\Helper\Idea\Tool\SessionLink"
      "helpLink" => "Project\View\Helper\HelpLink"
      "logLink" => "Project\View\Helper\LogLink"
      "pcaLink" => "Project\View\Helper\PcaLink"
      "helpFaqLink" => "Project\View\Helper\HelpFaqLink"
      "projectLink" => "Project\View\Helper\Project\ProjectLink"
      "documentLink" => "Project\View\Helper\Document\DocumentLink"
      "documentTypeLink" => "Project\View\Helper\Document\TypeLink"
      "versionLink" => "Project\View\Helper\Version\VersionLink"
      "versionDocumentLink" => "Project\View\Helper\Version\DocumentLink"
      "versionReviewerLink" => "Project\View\Helper\Version\ReviewerLink"
      "resultCategoryLink" => "Project\View\Helper\Result\CategoryLink"
      "resultTypeLink" => "Project\View\Helper\Result\TypeLink"
      "resultLink" => "Project\View\Helper\ResultLink"
      "reportLink" => "Project\View\Helper\Report\ReportLink"
      "reportHelper" => "Project\View\Helper\Report\ReportHelper"
      "reportItemLink" => "Project\View\Helper\Report\ItemLink"
      "reportReviewerLink" => "Project\View\Helper\Report\ReviewerLink"
      "projectReportWindowLink" => "Project\View\Helper\Report\WindowLink"
      "projectReportWindowProjectLink" => "Project\View\Helper\Report\Window\ProjectLink"
      "reportWorkpackageDescriptionLink" => "Project\View\Helper\Report\WorkpackageDescriptionLink"
      "workpackageLink" => "Project\View\Helper\Workpackage\WorkpackageLink"
      "workpackageDocumentLink" => "Project\View\Helper\Workpackage\DocumentLink"
      "workpackageTaskLink" => "Project\View\Helper\Workpackage\TaskLink"
      "workpackageDeliverableLink" => "Project\View\Helper\Workpackage\DeliverableLink"
      "workpackageDescriptionLink" => "Project\View\Helper\Workpackage\DescriptionLink"
      "workpackageDeliverableDocumentLink" => "Project\View\Helper\Workpackage\Deliverable\DocumentLink"
      "workpackageDeliverableTypeLink" => "Project\View\Helper\Workpackage\Deliverable\TypeLink"
      "posterLink" => "Project\View\Helper\PosterLink"
      "feeLink" => "Project\View\Helper\FeeLink"
      "ideaLink" => "Project\View\Helper\Idea\IdeaLink"
      "ideaToolLink" => "Project\View\Helper\Idea\ToolLink"
      "ideaInviteLink" => "Project\View\Helper\Idea\InviteLink"
      "ideaDescriptionLink" => "Project\View\Helper\Idea\DescriptionLink"
      "ideaPartnerLink" => "Project\View\Helper\Idea\PartnerLink"
      "ideaPosterLink" => "Project\View\Helper\Idea\PosterLink"
      "ideaPosterAttachment" => "Project\View\Helper\Idea\Poster\Attachment"
      "ideaPosterThumbnail" => "Project\View\Helper\Idea\Poster\Thumbnail"
      "ideaDocumentLink" => "Project\View\Helper\Idea\DocumentLink"
      "ideaImageLink" => "Project\View\Helper\Idea\ImageLink"
      "ideaVideoLink" => "Project\View\Helper\Idea\VideoLink"
      "ideaMeetingLink" => "Project\View\Helper\Idea\MeetingLink"
      "ideaMeetingInviteLink" => "Project\View\Helper\Idea\Meeting\InviteLink"
      "ideaMessageLink" => "Project\View\Helper\Idea\MessageLink"
      "ideaMessageDocumentLink" => "Project\View\Helper\Idea\Message\DocumentLink"
      "ideaStatusLink" => "Project\View\Helper\Idea\StatusLink"
      "ideaStatusDocumentLink" => "Project\View\Helper\Idea\Status\DocumentLink"
      "ideaDescriptionTypeLink" => "Project\View\Helper\Idea\Description\TypeLink"
      "buildHelp" => "Project\View\Helper\BuildHelp"
      "descriptionLink" => "Project\View\Helper\DescriptionLink"
      "buildDescription" => "Project\View\Helper\Description\BuildTree"
      "buildDescriptionNavigation" => "Project\View\Helper\Description\BuildNavigation"
      "buildDescriptionContent" => "Project\View\Helper\Description\BuildContent"
      "rationaleLink" => "Project\View\Helper\RationaleLink"
      "achievementLink" => "Project\View\Helper\Achievement\AchievementLink"
      "achievementTypeLink" => "Project\View\Helper\Achievement\TypeLink"
      "achievementCategoryLink" => "Project\View\Helper\Achievement\CategoryLink"
      "achievementExploitableResultLink" => "Project\View\Helper\Achievement\ExploitableResultLink"
      "achievementExploitableResultLinkLink" => "Project\View\Helper\Achievement\ExploitableResult\LinkLink"
      "achievementExploitableResultDocumentLink" => "Project\View\Helper\Achievement\ExploitableResult\DocumentLink"
      "changeRequestProcessLink" => "Project\View\Helper\ChangeRequest\ProcessLink"
      "changeRequestCostChangeLink" => "Project\View\Helper\ChangeRequest\CostChangeLink"
      "changeRequestCountryLink" => "Project\View\Helper\ChangeRequest\CountryLink"
      "projectCalendarReviewerLink" => "Project\View\Helper\Project\CalendarReviewerLink"
      "projectContractLink" => "Project\View\Helper\Contract\ContractLink"
      "contractDocumentLink" => "Project\View\Helper\Contract\DocumentLink"
      "contractVersionLink" => "Project\View\Helper\Contract\VersionLink"
      "contractVersionDocumentLink" => "Project\View\Helper\Contract\VersionDocumentLink"
      "actionLink" => "Project\View\Helper\Action\ActionLink"
      "actionTypeLink" => "Project\View\Helper\Action\TypeLink"
      "awardLink" => "Project\View\Helper\Award\AwardLink"
      "awardTypeLink" => "Project\View\Helper\Award\TypeLink"
      "eventLink" => "Project\View\Helper\EventLink"
      "eventTypeLink" => "Project\View\Helper\EventTypeLink"
      "projectformelement" => "Project\Form\View\Helper\ProjectFormElement"
      "resultselect" => "Project\Form\View\Helper\ResultSelect"
      "feedbackLink" => "Evaluation\View\Helper\FeedbackLink"
      "evaluationLink" => "Evaluation\View\Helper\EvaluationLink"
      "evaluationReportLink" => "Evaluation\View\Helper\ReportLink"
      "evaluationReportDownloadLink" => "Evaluation\View\Helper\Report\DownloadLink"
      "evaluationReportPresentationLink" => "Evaluation\View\Helper\Report\PresentationLink"
      "evaluationReportFinalLink" => "Evaluation\View\Helper\Report\FinalLink"
      "evaluationReportProgress" => "Evaluation\View\Helper\Report\Progress"
      "evaluationReportScore" => "Evaluation\View\Helper\Report\Score"
      "reportVersionLink" => "Evaluation\View\Helper\Report\VersionLink"
      "reportWindowLink" => "Evaluation\View\Helper\Report\WindowLink"
      "reportCriterionLink" => "Evaluation\View\Helper\Report\CriterionLink"
      "reportCriterionCategoryLink" => "Evaluation\View\Helper\Report\Criterion\CategoryLink"
      "reportCriterionTypeLink" => "Evaluation\View\Helper\Report\Criterion\TypeLink"
      "reportCriterionTopicLink" => "Evaluation\View\Helper\Report\Criterion\TopicLink"
      "reportCriterionVersionLink" => "Evaluation\View\Helper\Report\Criterion\VersionLink"
      "reviewerLink" => "Evaluation\View\Helper\ReviewerLink"
      "reviewerContactLink" => "Evaluation\View\Helper\Reviewer\ContactLink"
      "pressArticleLink" => "Press\View\Helper\ArticleLink"
      "bureauLink" => "Press\View\Helper\BureauLink"
      "programHandler" => "Program\View\Handler\ProgramHandler"
      "callInformationBox" => "Program\View\Helper\CallInformationBox"
      "programLink" => "Program\View\Helper\ProgramLink"
      "programDoaLink" => "Program\View\Helper\DoaLink"
      "callLink" => "Program\View\Helper\CallLink"
      "ndaLink" => "Program\View\Helper\NdaLink"
      "funderLink" => "Program\View\Helper\FunderLink"
      "callCountryLink" => "Program\View\Helper\CallCountryLink"
      "accessLink" => "Admin\View\Helper\AccessLink"
      "permitEntityLink" => "Admin\View\Helper\Permit\EntityLink"
      "permitRoleLink" => "Admin\View\Helper\Permit\RoleLink"
      "permitSetterLink" => "Admin\View\Helper\Permit\SetterLink"
      "queueLink" => "Admin\View\Helper\QueueLink"
      "oauth2clientlink" => "Admin\View\Helper\OAuth2\ClientLink"
      "oauth2scopelink" => "Admin\View\Helper\OAuth2\ScopeLink"
      "apiLogLink" => "Admin\View\Helper\Api\LogLink"
      "accessformelement" => "Admin\Form\View\Helper\AccessFormElement"
      "ztbalert" => "lbs5alert"
      "ztbformelement" => "lbs5formelement"
      "filterbarelement" => "lbs5filterbarelement"
      "lbs5navigation" => "LaminasBootstrap5\View\Helper\Navigation"
      "lbs5filterbarelement" => "LaminasBootstrap5\Form\View\Helper\FilterBarElement"
      "lbs5filtercolumnelement" => "LaminasBootstrap5\Form\View\Helper\FilterColumnElement"
      "lbs5formelement" => "LaminasBootstrap5\Form\View\Helper\FormElement"
      "lbs5formcheckbox" => "LaminasBootstrap5\Form\View\Helper\FormCheckbox"
      "associateLink" => "Affiliation\View\Helper\AssociateLink"
      "affiliationLink" => "Affiliation\View\Helper\AffiliationLink"
      "affiliationDoaLink" => "Affiliation\View\Helper\DoaLink"
      "affiliationLoiLink" => "Affiliation\View\Helper\LoiLink"
      "paymentSheet" => "Affiliation\View\Helper\PaymentSheet"
      "affiliationEffortSpentLink" => "Affiliation\View\Helper\EffortSpentLink"
      "affiliationQuestionCategoryLink" => "Affiliation\View\Helper\Questionnaire\CategoryLink"
      "affiliationQuestionLink" => "Affiliation\View\Helper\Questionnaire\QuestionLink"
      "affiliationQuestionnaireLink" => "Affiliation\View\Helper\Questionnaire\QuestionnaireLink"
      "questionnaireHelper" => "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper"
      "organisationLink" => "Organisation\View\Helper\OrganisationLink"
      "organisationTypeLink" => "Organisation\View\Helper\Organisation\TypeLink"
      "organisationLogo" => "Organisation\View\Helper\OrganisationLogo"
      "organisationNoteLink" => "Organisation\View\Helper\NoteLink"
      "boardLink" => "Organisation\View\Helper\BoardLink"
      "organisationSelectionLink" => "Organisation\View\Helper\SelectionLink"
      "parentLink" => "Organisation\View\Helper\Parent\ParentLink"
      "parentOrganisationLink" => "Organisation\View\Helper\Parent\OrganisationLink"
      "parentDoaLink" => "Organisation\View\Helper\Parent\DoaLink"
      "parentTypeLink" => "Organisation\View\Helper\Parent\TypeLink"
      "parentFinancialLink" => "Organisation\View\Helper\Parent\FinancialLink"
      "advisoryBoardCityLink" => "Organisation\View\Helper\AdvisoryBoard\CityLink"
      "advisoryBoardCityImage" => "Organisation\View\Helper\AdvisoryBoard\CityImage"
      "advisoryBoardSolutionLink" => "Organisation\View\Helper\AdvisoryBoard\SolutionLink"
      "advisoryBoardSolutionImage" => "Organisation\View\Helper\AdvisoryBoard\SolutionImage"
      "organisationUpdateLink" => "Organisation\View\Helper\UpdateLink"
      "organisationUpdateLogo" => "Organisation\View\Helper\UpdateLogo"
      "organisationUpdateNotification" => "Organisation\View\Helper\UpdateNotification"
      "overviewVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution"
      "overviewExtraVariableContribution" => "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution"
      "organisationselect" => "Organisation\Form\View\Helper\OrganisationFormElement"
      "parentformelement" => "Organisation\Form\View\Helper\ParentFormElement"
      "publicationLink" => "Publication\View\Helper\PublicationLink"
      "publicationTypeLink" => "Publication\View\Helper\TypeLink"
      "publicationCategoryLink" => "Publication\View\Helper\CategoryLink"
      "invoiceLink" => "Invoice\View\Helper\InvoiceLink"
      "transactionLink" => "Invoice\View\Helper\TransactionLink"
      "invoiceRowLink" => "Invoice\View\Helper\RowLink"
      "dimensionLink" => "Invoice\View\Helper\DimensionLink"
      "invoicePdfLink" => "Invoice\View\Helper\PdfLink"
      "invoiceWordLink" => "Invoice\View\Helper\WordLink"
      "reminderLink" => "Invoice\View\Helper\ReminderLink"
      "reminderInvoiceOverview" => "Invoice\View\Helper\ReminderInvoiceOverview"
      "journalLink" => "Invoice\View\Helper\JournalLink"
      "dailyUpdateHandler" => "Invoice\View\Helper\DailyUpdateHandler"
      "canAssemble" => "Deeplink\View\Helper\CanAssemble"
      "deeplinkLink" => "Deeplink\View\Helper\DeeplinkLink"
      "deeplinkTargetLink" => "Deeplink\View\Helper\Deeplink\TargetLink"
      "deskCostsLink" => "Event\View\Helper\DeskCostsLink"
      "meetingLink" => "Event\View\Helper\Meeting\MeetingLink"
      "meetingOptionLink" => "Event\View\Helper\Meeting\OptionLink"
      "meetingOptionCostLink" => "Event\View\Helper\Meeting\OptionCostLink"
      "meetingCostLink" => "Event\View\Helper\Meeting\CostLink"
      "meetingQuotaLink" => "Event\View\Helper\Meeting\QuotaLink"
      "meetingCouponLink" => "Event\View\Helper\CouponLink"
      "boothLink" => "Event\View\Helper\Booth\BoothLink"
      "boothSpecLink" => "Event\View\Helper\Booth\SpecLink"
      "exhibitionLink" => "Event\View\Helper\Exhibition\ExhibitionLink"
      "registrationLink" => "Event\View\Helper\RegistrationLink"
      "meetingFloorplanLink" => "Event\View\Helper\Meeting\FloorplanLink"
      "exhibitionSpecLink" => "Event\View\Helper\Exhibition\SpecLink"
      "exhibitionCostLink" => "Event\View\Helper\Exhibition\CostLink"
      "badgeLink" => "Event\View\Helper\Badge\BadgeLink"
      "badgeAttachmentLink" => "Event\View\Helper\Badge\AttachmentLink"
      "badgeImage" => "Event\View\Helper\Badge\Image"
      "badgeContactLink" => "Event\View\Helper\Badge\ContactLink"
      "ticketImage" => "Event\View\Helper\Ticket\Image"
      "ticketLink" => "Event\View\Helper\Ticket\TicketLink"
      "calendarDocumentLink" => "Calendar\View\Helper\DocumentLink"
      "calendarTypeLink" => "Calendar\View\Helper\TypeLink"
      "calendarLink" => "Calendar\View\Helper\CalendarLink"
      "mailingLink" => "Mailing\View\Helper\MailingLink"
      "attachmentLink" => "Mailing\View\Helper\AttachmentLink"
      "mailingContactLink" => "Mailing\View\Helper\MailingContactLink"
      "mailingTemplateLink" => "Mailing\View\Helper\TemplateLink"
      "senderLink" => "Mailing\View\Helper\SenderLink"
      "emailMessageEventIcon" => "Mailing\View\Helper\EmailMessageEventIcon"
    ]
    "factories" => array:348 [
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\ApiTools\Documentation\View\AgAcceptHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgContentTypeHeaders" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgServicePath" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgStatusCodes" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\ApiTools\Documentation\View\AgTransformDescription" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Hal" => "Laminas\ApiTools\Hal\Factory\HalViewHelperFactory"
      "AssetManager\View\Helper\Asset" => "AssetManager\Service\AssetViewHelperFactory"
      "isAllowed" => "BjyAuthorize\View\Helper\IsAllowedFactory"
      "Content\View\Helper\NodeLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ParamLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\HandlerLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\SegmentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TemplateLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ContentLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\RouteLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\TopicLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Image" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Content\View\Helper\Video" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\NodeTableRow" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ImageHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ArticleHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Handler\ContentHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Content\View\Helper\PaginationLink" => "Application\Factory\InvokableFactory"
      "Content\View\Helper\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\ChallengeIcon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\ChallengeImage" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Image" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Challenge\Idea\Poster\Icon" => "General\View\Factory\ImageHelperFactory"
      "General\View\Helper\Country\CountryFlag" => "General\View\Factory\ImageHelperFactory"
      "General\View\Handler\CountryHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ImpactStreamHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Handler\ChallengeHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\Challenge\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Challenge\ChallengeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\CurrencyLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ExchangeRateLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\PasswordLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LanguageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\GenderLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\EmailMessageLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\TitleLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\VatTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\WebInfoLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\ContentTypeLink" => "General\View\Factory\LinkHelperFactory"
      "General\View\Helper\Country\CountryMap" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "General\View\Helper\ContentTypeIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Cluster\View\Helper\ClusterLink" => "General\View\Factory\LinkHelperFactory"
      "Cluster\View\Helper\Cluster\Logo" => "General\View\Factory\ImageHelperFactory"
      "News\View\Handler\NewsHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\BlogHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Handler\MagazineHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "News\View\Helper\BlogLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\TagLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Blog\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\NewsLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\News\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\MagazineLink" => "General\View\Factory\LinkHelperFactory"
      "News\View\Helper\Magazine\ArticleLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\DndLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ProfileLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Selection\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\FacebookLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\OptInLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\AddressLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\NoteLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\PhoneLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\ContactPhoto" => "General\View\Factory\ImageHelperFactory"
      "Contact\View\Helper\Office\ContactLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\View\Helper\Office\LeaveLink" => "General\View\Factory\LinkHelperFactory"
      "Contact\Form\View\Helper\ContactFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Contact\Form\View\Helper\SelectionFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\StatusBadge" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Quality\View\Helper\PhaseLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\YearLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\KpiLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\TargetLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Kpi\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Quality\View\Helper\Action\SourceLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\GroupLink" => "General\View\Factory\LinkHelperFactory"
      "Quality\View\Helper\Action\Result\Matrix" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\Form\View\Helper\ProjectFormElement" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ProjectHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\ResultHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Handler\IdeaHandler" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectLogo" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Project\Quickstart" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\StatusIcon" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\ProjectDates" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Project\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaImage" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\SelectionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\LogLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PcaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\HelpFaqLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Document\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\VersionLink" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Version\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Version\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Result\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReportHelper" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Report\ItemLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\ReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\Window\ProjectLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Report\WorkpackageDescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\WorkpackageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\TaskLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DeliverableLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Workpackage\Deliverable\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\FeeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\IdeaLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ToolLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PosterLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\PartnerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Description\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MeetingLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Meeting\InviteLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\VideoLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\MessageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Message\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\StatusLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Status\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\ImageLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Idea\Poster\Attachment" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Poster\Thumbnail" => "General\View\Factory\ImageHelperFactory"
      "Project\View\Helper\Idea\Tool\SessionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\BuildHelp" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\DescriptionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Description\BuildTree" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildContent" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\Description\BuildNavigation" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Project\View\Helper\RationaleLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\AchievementLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\CategoryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResultLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\LinkLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Achievement\ExploitableResult\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\ProcessLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CostChangeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\ChangeRequest\CountryLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Project\CalendarReviewerLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\ContractLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\DocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Contract\VersionDocumentLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\ActionLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Action\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\AwardLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\Award\TypeLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventLink" => "General\View\Factory\LinkHelperFactory"
      "Project\View\Helper\EventTypeLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\FeedbackLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\EvaluationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\ReportLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\DownloadLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\PresentationLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\FinalLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Progress" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\Score" => "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory"
      "Evaluation\View\Helper\Report\VersionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\WindowLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\CriterionLink" => "General\View\Factory\LinkHelperFactory"
      "Evaluation\View\Helper\Report\Criterion\CategoryLink" => "General\View\Factory\LinkHelperFactory"
       …109
    ]
    "invokables" => array:18 [ …18]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:2 [ …2]
  ]
  "controller_plugins" => array:3 [
    "aliases" => array:100 [ …100]
    "factories" => array:89 [ …89]
    "invokables" => array:2 [ …2]
  ]
  "asset_manager" => array:6 [
    "resolver_configs" => array:4 [ …4]
    "clear_output_buffer" => true
    "resolvers" => array:6 [ …6]
    "view_helper" => array:3 [ …3]
    "caching" => array:4 [ …4]
    "filters" => array:2 [ …2]
  ]
  "api-tools" => array:1 [
    "db-connected" => []
  ]
  "controllers" => array:4 [
    "aliases" => array:3 [ …3]
    "factories" => array:330 [ …330]
    "abstract_factories" => array:2 [ …2]
    "invokables" => array:3 [ …3]
  ]
  "api-tools-content-negotiation" => array:6 [
    "controllers" => array:2 [ …2]
    "accept_whitelist" => array:1 [ …1]
    "selectors" => array:3 [ …3]
    "content_type_whitelist" => []
    "x_http_method_override_enabled" => false
    "http_override_methods" => []
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:5 [ …5]
    "display_exceptions" => true
    "template_map" => array:1497 [ …1497]
    "strategies" => array:2 [ …2]
    "display_not_found_reason" => true
    "doctype" => "HTML5"
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
  ]
  "api-tools-api-problem" => []
  "api-tools-configuration" => array:1 [
    "config_file" => "config/autoload/development.php"
  ]
  "api-tools-oauth2" => array:7 [
    "grant_types" => array:5 [ …5]
    "api_problem_error_response" => true
    "storage" => "Laminas\ApiTools\OAuth2\Adapter\PdoAdapter"
    "options" => array:6 [ …6]
    "allow_implicit" => true
    "access_lifetime" => 3600
    "enforce_state" => true
  ]
  "api-tools-mvc-auth" => array:2 [
    "authentication" => array:2 [ …2]
    "authorization" => array:2 [ …2]
  ]
  "api-tools-hal" => array:3 [
    "renderer" => []
    "metadata_map" => []
    "options" => array:1 [ …1]
  ]
  "filters" => array:1 [
    "factories" => array:2 [ …2]
  ]
  "validators" => array:2 [
    "factories" => array:8 [ …8]
    "aliases" => array:3 [ …3]
  ]
  "input_filter_specs" => []
  "api-tools-content-validation" => array:1 [
    "methods_without_bodies" => []
  ]
  "api-tools-rest" => array:1 [
    "Api\V1\Rest\ContactResource\MeListener" => array:11 [ …11]
  ]
  "api-tools-rpc" => []
  "api-tools-versioning" => array:3 [
    "content-type" => []
    "default_version" => 1
    "uri" => []
  ]
  "bjyauthorize" => array:12 [
    "guards" => array:1 [ …1]
    "default_role" => "guest"
    "authenticated_role" => "user"
    "identity_provider" => "Jield\Authorize\Provider\Identity\AuthenticationIdentityProvider"
    "role_providers" => array:1 [ …1]
    "resource_providers" => []
    "rule_providers" => []
    "unauthorized_strategy" => "Jield\Authorize\View\UnauthorizedStrategy"
    "template" => "error/403"
    "cache_enabled" => true
    "cache_options" => array:2 [ …2]
    "cache_key" => "bjyauthorize_acl"
  ]
  "doctrine" => array:15 [
    "driver" => array:22 [ …22]
    "cache" => array:11 [ …11]
    "authentication" => array:2 [ …2]
    "authenticationadapter" => array:2 [ …2]
    "authenticationstorage" => array:2 [ …2]
    "authenticationservice" => array:2 [ …2]
    "connection" => array:1 [ …1]
    "configuration" => array:1 [ …1]
    "entitymanager" => array:1 [ …1]
    "eventmanager" => array:1 [ …1]
    "sql_logger_collector" => array:1 [ …1]
    "mapping_collector" => array:1 [ …1]
    "entity_resolver" => array:1 [ …1]
    "migrations_configuration" => array:1 [ …1]
    "migrations_cmd" => array:13 [ …13]
  ]
  "Laminas\ServiceManager\AbstractFactory\ConfigAbstractFactory" => array:608 [
    "Api\V1\Rest\ContactResource\MeListener" => array:2 [ …2]
    "Jield\Authorize\View\UnauthorizedStrategy" => array:2 [ …2]
    "Application\Twig\DatabaseTwigLoader" => array:1 [ …1]
    "Application\Event\SetTitle" => array:2 [ …2]
    "Application\Event\InjectAclInNavigation" => array:2 [ …2]
    "Application\Event\BlockInactiveContact" => array:1 [ …1]
    "Application\Event\RegisterPageview" => array:3 [ …3]
    "Application\Authentication\Storage\AuthenticationStorage" => array:2 [ …2]
    "Laminas\Authentication\AuthenticationService" => array:1 [ …1]
    "Application\Session\SaveHandler\DoctrineGateway" => array:2 [ …2]
    "Content\Controller\Json\ArticleController" => array:1 [ …1]
    "Content\Controller\Json\ImageController" => array:3 [ …3]
    "Content\Controller\Json\NodeController" => array:3 [ …3]
    "Content\Controller\ArticleController" => array:4 [ …4]
    "Content\Controller\ContentController" => array:1 [ …1]
    "Content\Controller\ImageController" => array:4 [ …4]
    "Content\Controller\VideoController" => array:4 [ …4]
    "Content\Controller\NodeController" => array:3 [ …3]
    "Content\Controller\NodeManagerController" => array:4 [ …4]
    "Content\Controller\RedirectController" => array:3 [ …3]
    "Content\Navigation\Service\ContentNavigationService" => array:7 [ …7]
    "Content\InputFilter\HandlerFilter" => array:1 [ …1]
    "Content\InputFilter\RouteFilter" => array:1 [ …1]
    "Content\InputFilter\SegmentFilter" => array:1 [ …1]
    "Content\InputFilter\TemplateFilter" => array:1 [ …1]
    "Content\InputFilter\TopicFilter" => array:1 [ …1]
    "Content\Service\ArticleService" => array:1 [ …1]
    "Content\Service\VimeoService" => array:2 [ …2]
    "Content\Service\RouteService" => array:1 [ …1]
    "Content\Service\ContentService" => array:1 [ …1]
    "Content\Service\NodeService" => array:2 [ …2]
    "Content\View\Helper\BuildNavigation" => array:3 [ …3]
    "Content\View\Helper\NodeTableRow" => array:2 [ …2]
    "Content\View\Helper\Image" => array:3 [ …3]
    "Content\View\Handler\ArticleHandler" => array:8 [ …8]
    "Content\View\Handler\ContentHandler" => array:8 [ …8]
    "Content\View\Handler\ImageHandler" => array:8 [ …8]
    "General\Controller\ChallengeController" => array:4 [ …4]
    "General\Controller\ChallengeTypeController" => array:3 [ …3]
    "General\Controller\ContentTypeController" => array:3 [ …3]
    "General\Controller\LanguageController" => array:3 [ …3]
    "General\Controller\CountryController" => array:4 [ …4]
    "General\Controller\Country\VideoController" => array:3 [ …3]
    "General\Controller\CurrencyController" => array:3 [ …3]
    "General\Controller\EmailController" => array:2 [ …2]
    "General\Controller\ExchangeRateController" => array:3 [ …3]
    "General\Controller\GenderController" => array:3 [ …3]
    "General\Controller\ImageController" => array:2 [ …2]
    "General\Controller\ImpactStreamController" => array:3 [ …3]
    "General\Controller\LogController" => array:3 [ …3]
    "General\Controller\PasswordController" => array:3 [ …3]
    "General\Controller\TitleController" => array:3 [ …3]
    "General\Controller\VatController" => array:3 [ …3]
    "General\Controller\VatTypeController" => array:3 [ …3]
    "General\Controller\WebInfoController" => array:4 [ …4]
    "General\Service\GeneralService" => array:1 [ …1]
    "General\Service\CountryService" => array:3 [ …3]
    "General\View\Handler\ImpactStreamHandler" => array:9 [ …9]
    "General\View\Handler\ChallengeHandler" => array:7 [ …7]
    "General\View\Handler\CountryHandler" => array:9 [ …9]
    "General\View\Helper\ContentTypeIcon" => array:1 [ …1]
    "General\View\Helper\Country\CountryMap" => array:2 [ …2]
    "General\Search\Service\CountrySearchService" => array:1 [ …1]
    "Cluster\Command\UpdateProject" => array:4 [ …4]
    "Cluster\Command\GenerateProjectJson" => array:2 [ …2]
    "Cluster\Controller\Admin\ClusterController" => array:4 [ …4]
    "Cluster\Controller\ImageController" => array:1 [ …1]
    "Cluster\Service\ClusterService" => array:1 [ …1]
    "Cluster\Service\StatisticsService" => array:1 [ …1]
    "Cluster\Form\ClusterForm" => array:1 [ …1]
    "News\Controller\BlogController" => array:4 [ …4]
    "News\Controller\Blog\CategoryController" => array:3 [ …3]
    "News\Controller\Blog\TagController" => array:3 [ …3]
    "News\Controller\Blog\MessageController" => array:3 [ …3]
    "News\Controller\NewsController" => array:4 [ …4]
    "News\Controller\News\CategoryController" => array:3 [ …3]
    "News\Controller\MagazineController" => array:4 [ …4]
    "News\Controller\Magazine\ArticleController" => array:4 [ …4]
    "News\Service\BlogService" => array:4 [ …4]
    "News\Service\NewsService" => array:3 [ …3]
    "News\Service\MagazineService" => array:1 [ …1]
    "News\Search\Service\NewsSearchService" => array:1 [ …1]
    "News\Search\Service\BlogSearchService" => array:1 [ …1]
    "News\View\Handler\NewsHandler" => array:7 [ …7]
    "News\View\Handler\BlogHandler" => array:7 [ …7]
    "News\View\Handler\MagazineHandler" => array:6 [ …6]
    "Contact\Controller\AddressManagerController" => array:3 [ …3]
    "Contact\Controller\ContactAdminController" => array:12 [ …12]
    "Contact\Controller\ContactDetailsController" => array:10 [ …10]
    "Contact\Controller\ContactController" => array:3 [ …3]
    "Contact\Controller\DndController" => array:5 [ …5]
    "Contact\Controller\FacebookController" => array:3 [ …3]
    "Contact\Controller\FacebookManagerController" => array:3 [ …3]
    "Contact\Controller\OptInManagerController" => array:3 [ …3]
    "Contact\Controller\ImageController" => array:1 [ …1]
    "Contact\Controller\NoteManagerController" => array:3 [ …3]
    "Contact\Controller\PhoneManagerController" => array:3 [ …3]
    "Contact\Controller\ProfileController" => array:10 [ …10]
    "Contact\Controller\Selection\ManagerController" => array:7 [ …7]
    "Contact\Controller\Selection\TypeController" => array:3 [ …3]
    "Contact\Controller\Office\ContactController" => array:2 [ …2]
    "Contact\Controller\Office\LeaveController" => array:3 [ …3]
    "Contact\Command\Cleanup" => array:1 [ …1]
    "Contact\Command\ResetAccess" => array:1 [ …1]
    "Contact\Provider\ContactProvider" => array:1 [ …1]
    "Contact\Controller\Plugin\MergeContact" => array:3 [ …3]
    "Contact\Controller\Plugin\ContactActions" => array:3 [ …3]
    "Contact\Controller\Plugin\HandleImport" => array:6 [ …6]
    "Contact\Controller\Plugin\SelectionExport" => array:4 [ …4]
    "Contact\Search\Service\ContactSearchService" => array:1 [ …1]
    "Contact\Search\Service\ProfileSearchService" => array:1 [ …1]
    "Contact\Form\ContactForm" => array:1 [ …1]
    "Contact\Form\View\Helper\ContactFormElement" => array:3 [ …3]
    "Contact\Form\View\Helper\SelectionFormElement" => array:2 [ …2]
    "Contact\Service\AddressService" => array:1 [ …1]
    "Contact\Service\ContactService" => array:9 [ …9]
    "Contact\Service\SelectionContactService" => array:1 [ …1]
    "Contact\Service\SelectionService" => array:3 [ …3]
    "Contact\Service\Office\ContactService" => array:1 [ …1]
    "Quality\Controller\IndexController" => array:1 [ …1]
    "Quality\Controller\ProcessController" => array:2 [ …2]
    "Quality\Controller\PhaseController" => array:2 [ …2]
    "Quality\Controller\StatusController" => array:2 [ …2]
    "Quality\Controller\YearController" => array:2 [ …2]
    "Quality\Controller\ActionController" => array:2 [ …2]
    "Quality\Controller\TargetController" => array:2 [ …2]
    "Quality\Controller\KpiController" => array:2 [ …2]
    "Quality\Controller\Kpi\TargetController" => array:2 [ …2]
    "Quality\Controller\Kpi\GroupController" => array:2 [ …2]
    "Quality\Controller\Kpi\ResultController" => array:2 [ …2]
    "Quality\Controller\Kpi\Result\MatrixController" => array:1 [ …1]
    "Quality\Controller\Kpi\ActionController" => array:1 [ …1]
    "Quality\Controller\Action\SourceController" => array:2 [ …2]
    "Quality\Controller\Action\GroupController" => array:2 [ …2]
    "Quality\Controller\Action\ResultController" => array:2 [ …2]
    "Quality\Controller\Action\Result\MatrixController" => array:2 [ …2]
    "Quality\Service\QualityService" => array:2 [ …2]
    "Quality\View\Helper\Kpi\Result\Matrix" => array:2 [ …2]
    "Quality\View\Helper\Action\Result\Matrix" => array:2 [ …2]
    "Project\Controller\Json\AchievementController" => array:1 [ …1]
    "Project\Controller\Json\Achievement\ExploitableResultController" => array:1 [ …1]
    "Project\Controller\Json\ContractController" => array:3 [ …3]
    "Project\Controller\Json\CostController" => array:5 [ …5]
    "Project\Controller\Json\DescriptionController" => array:1 [ …1]
    "Project\Controller\Json\EffortController" => array:6 [ …6]
    "Project\Controller\Json\FundingController" => array:3 [ …3]
    "Project\Controller\Json\FundingStatusController" => array:2 [ …2]
    "Project\Controller\Json\HelpController" => array:1 [ …1]
    "Project\Controller\Json\IdeaController" => array:1 [ …1]
    "Project\Controller\Json\Idea\ToolController" => array:2 [ …2]
    "Project\Controller\Json\Idea\PosterController" => array:2 [ …2]
    "Project\Controller\Json\InviteController" => array:6 [ …6]
    "Project\Controller\Json\ReportController" => array:1 [ …1]
    "Project\Controller\Json\ResultController" => array:1 [ …1]
    "Project\Controller\Json\WorkpackageController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\TaskController" => array:3 [ …3]
    "Project\Controller\Json\Workpackage\DeliverableController" => array:3 [ …3]
    "Project\Controller\Action\TypeController" => array:3 [ …3]
    "Project\Controller\Action\ActionController" => array:10 [ …10]
    "Project\Controller\Event\TypeController" => array:3 [ …3]
    "Project\Controller\SelectionController" => array:4 [ …4]
    "Project\Controller\Event\EventController" => array:5 [ …5]
    "Project\Controller\ChangeRequest\ChangeRequestController" => array:7 [ …7]
    "Project\Controller\ChangeRequest\ProcessController" => array:9 [ …9]
    "Project\Controller\ChangeRequest\UpdateController" => array:14 [ …14]
    "Project\Controller\ChangeRequest\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\ManagerController" => array:7 [ …7]
    "Project\Controller\Idea\Admin\DetailsController" => array:3 [ …3]
    "Project\Controller\Idea\PosterManagerController" => array:5 [ …5]
    "Project\Controller\Idea\PosterController" => array:1 [ …1]
    "Project\Controller\Achievement\AchievementController" => array:6 [ …6]
    "Project\Controller\Achievement\ExploitableResultController" => array:6 [ …6]
    "Project\Controller\Achievement\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\TypeController" => array:2 [ …2]
    "Project\Controller\Achievement\CategoryController" => array:4 [ …4]
    "Project\Controller\Achievement\ExploitableResult\ManagerController" => array:5 [ …5]
    "Project\Controller\Achievement\ExploitableResult\LinkController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Link\ManagerController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\DocumentController" => array:3 [ …3]
    "Project\Controller\Achievement\ExploitableResult\Document\ManagerController" => array:3 [ …3]
    "Project\Controller\Award\AwardController" => array:3 [ …3]
    "Project\Controller\Award\TypeController" => array:2 [ …2]
    "Project\Controller\Contract\ContractController" => array:6 [ …6]
    "Project\Controller\Contract\DocumentController" => array:1 [ …1]
    "Project\Controller\Contract\VersionController" => array:3 [ …3]
    "Project\Controller\CommunityController" => array:21 [ …21]
    "Project\Controller\Rationale\RationaleController" => array:10 [ …10]
    "Project\Controller\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\DocumentController" => array:5 [ …5]
    "Project\Controller\Document\TypeController" => array:2 [ …2]
    "Project\Controller\EditController" => array:14 [ …14]
    "Project\Controller\FeeManagerController" => array:2 [ …2]
    "Project\Controller\HelpController" => array:3 [ …3]
    "Project\Controller\EventManagerController" => array:4 [ …4]
    "Project\Controller\HelpManagerController" => array:3 [ …3]
    "Project\Controller\ImageController" => array:1 [ …1]
    "Project\Controller\Idea\IdeaController" => array:13 [ …13]
    "Project\Controller\Idea\InviteController" => array:3 [ …3]
    "Project\Controller\Idea\DescriptionController" => array:2 [ …2]
    "Project\Controller\Idea\Description\TypeController" => array:2 [ …2]
    "Project\Controller\Idea\ToolController" => array:1 [ …1]
    "Project\Controller\Idea\ToolManagerController" => array:4 [ …4]
    "Project\Controller\Idea\Tool\Session\ManagerController" => array:5 [ …5]
    "Project\Controller\Idea\Tool\SessionController" => array:2 [ …2]
    "Project\Controller\Idea\PartnerController" => array:3 [ …3]
    "Project\Controller\Idea\DocumentController" => array:2 [ …2]
    "Project\Controller\Idea\ImageController" => array:2 [ …2]
    "Project\Controller\Idea\VideoController" => array:3 [ …3]
    "Project\Controller\Idea\MeetingController" => array:4 [ …4]
    "Project\Controller\Idea\MeetingManagerController" => array:3 [ …3]
    "Project\Controller\Idea\Meeting\InviteController" => array:5 [ …5]
    "Project\Controller\Idea\MessageController" => array:3 [ …3]
    "Project\Controller\Idea\Message\DocumentController" => array:1 [ …1]
    "Project\Controller\Idea\StatusController" => array:3 [ …3]
    "Project\Controller\Idea\Status\DocumentController" => array:1 [ …1]
    "Project\Controller\InviteController" => array:6 [ …6]
    "Project\Controller\PcaController" => array:3 [ …3]
    "Project\Controller\PcaManagerController" => array:5 [ …5]
    "Project\Controller\LogManagerController" => array:5 [ …5]
    "Project\Controller\Project\AdminController" => array:23 [ …23]
    "Project\Controller\Project\CalendarManagerController" => array:3 [ …3]
    "Project\Controller\Project\ProjectController" => array:2 [ …2]
    "Project\Controller\Project\DetailsController" => array:24 [ …24]
    "Project\Controller\Project\ExportController" => array:1 [ …1]
    "Project\Controller\Project\ManagerController" => array:8 [ …8]
    "Project\Controller\Rationale\ManagerController" => array:4 [ …4]
    "Project\Controller\Report\ReportController" => array:6 [ …6]
    "Project\Controller\Report\DetailsController" => array:11 [ …11]
    "Project\Controller\Report\ItemController" => array:3 [ …3]
    "Project\Controller\Report\ManagerController" => array:10 [ …10]
    "Project\Controller\Report\WindowController" => array:3 [ …3]
    "Project\Controller\Report\Window\ProjectController" => array:2 [ …2]
    "Project\Controller\Result\CategoryController" => array:2 [ …2]
    "Project\Controller\Result\ManagerController" => array:6 [ …6]
    "Project\Controller\Result\TypeController" => array:2 [ …2]
    "Project\Controller\RoadmapController" => array:5 [ …5]
    "Project\Controller\Version\VersionController" => array:11 [ …11]
    "Project\Controller\Version\DocumentController" => array:5 [ …5]
    "Project\Controller\Version\Document\ManagerController" => array:6 [ …6]
    "Project\Controller\Version\ManagerController" => array:15 [ …15]
    "Project\Controller\Version\TypeController" => array:3 [ …3]
    "Project\Controller\Workpackage\WorkpackageController" => array:7 [ …7]
    "Project\Controller\Workpackage\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\DocumentManagerController" => array:5 [ …5]
    "Project\Controller\Workpackage\Deliverable\DocumentController" => array:4 [ …4]
    "Project\Controller\Workpackage\Deliverable\DocumentManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionController" => array:4 [ …4]
    "Project\Controller\Workpackage\DescriptionManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableController" => array:4 [ …4]
    "Project\Controller\Workpackage\DeliverableManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskController" => array:4 [ …4]
    "Project\Controller\Workpackage\TaskManagerController" => array:4 [ …4]
    "Project\Controller\Workpackage\ManagerController" => array:6 [ …6]
    "Project\Controller\Workpackage\Deliverable\TypeController" => array:3 [ …3]
    "Project\Controller\StatisticsController" => array:1 [ …1]
    "Project\Provider\ProjectProvider" => array:6 [ …6]
    "Project\Provider\Version\VersionProvider" => array:3 [ …3]
    "Project\Job\CometChat\CreateIdeaGroup" => array:4 [ …4]
    "Project\Job\CometChat\UpdateMembersOfIdeaGroup" => array:4 [ …4]
    "Project\Controller\Plugin\CreateExport" => array:4 [ …4]
    "Project\Controller\Plugin\SelectionExport" => array:5 [ …5]
    "Project\Controller\Plugin\Merge\CreateMergedDocument" => array:12 [ …12]
    "Project\Controller\Plugin\Merge\CreateSummaryDocument" => array:4 [ …4]
    "Project\Controller\Plugin\Merge\CreateMergedProjectReport" => array:13 [ …13]
    "Project\Controller\Plugin\Merge\CreateMergedChangeRequestDocument" => array:7 [ …7]
    "Project\Controller\Plugin\CreateVersion" => array:7 [ …7]
    "Project\Controller\Plugin\Checklist\ProjectChecklist" => array:8 [ …8]
    "Project\Controller\Plugin\Checklist\ReportChecklist" => array:5 [ …5]
    "Project\Controller\Plugin\Changes\ProjectChanges" => array:5 [ …5]
    "Project\Controller\Plugin\Checklist\ChangeRequestChecklist" => array:7 [ …7]
    "Project\Controller\Plugin\RenderReportWorkpackageDescriptions" => array:2 [ …2]
    "Project\Controller\Plugin\RenderVersionStatistics" => array:7 [ …7]
    "Project\Controller\Plugin\Achievement\Export" => array:2 [ …2]
    "Project\Controller\Plugin\Achievement\Import" => array:2 [ …2]
    "Project\Controller\Plugin\ActionExport" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\IdeasPerCountryDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Invite\Accept" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\SendMessage" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Send" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Accept" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Meeting\Invite\Decline" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Export" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionPdf" => array:2 [ …2]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionSpreadsheet" => array:4 [ …4]
    "Project\Controller\Plugin\Idea\Tool\Session\SessionDocument" => array:6 [ …6]
    "Project\Controller\Plugin\Idea\Poster\PosterPdf" => array:3 [ …3]
    "Project\InputFilter\RationaleFilter" => array:1 [ …1]
    "Project\Form\ProjectForm" => array:1 [ …1]
    "Project\Service\ProjectService" => array:9 [ …9]
    "Project\Service\ActionService" => array:5 [ …5]
    "Project\Service\VersionService" => array:3 [ …3]
    "Project\Service\WorkpackageService" => array:4 [ …4]
    "Project\Service\IdeaService" => array:12 [ …12]
    "Project\Service\Idea\MeetingService" => array:2 [ …2]
    "Project\Service\Idea\Tool\SessionService" => array:2 [ …2]
    "Project\Service\DescriptionService" => array:3 [ …3]
    "Project\Service\ResultService" => array:4 [ …4]
    "Project\Service\VersionDocumentService" => array:4 [ …4]
    "Project\Service\EventService" => array:2 [ …2]
    "Project\Service\HelpService" => array:2 [ …2]
    "Project\Service\KeywordService" => array:1 [ …1]
    "Project\Service\AchievementService" => array:4 [ …4]
    "Project\Service\Achievement\ExploitableResultService" => array:4 [ …4]
    "Project\Service\ReportService" => array:2 [ …2]
    "Project\Service\DocumentService" => array:1 [ …1]
    "Project\Service\ContractService" => array:2 [ …2]
    "Project\Service\InviteService" => array:6 [ …6]
    "Project\Service\SelectionService" => array:1 [ …1]
    "Project\Service\AwardService" => array:1 [ …1]
    "Project\Service\ChangeRequestService" => array:7 [ …7]
    "Project\Service\Report\WindowService" => array:1 [ …1]
    "Project\Search\Service\AchievementSearchService" => array:1 [ …1]
    "Project\Search\Service\Achievement\ExploitableResultSearchService" => array:1 [ …1]
    "Project\Search\Service\IdeaSearchService" => array:1 [ …1]
    "Project\Search\Service\DescriptionSearchService" => array:1 [ …1]
    "Project\Search\Service\ProjectSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionSearchService" => array:1 [ …1]
    "Project\Search\Service\VersionDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\WorkpackageDocumentSearchService" => array:1 [ …1]
    "Project\Search\Service\ResultSearchService" => array:1 [ …1]
    "Project\Search\Service\ActionSearchService" => array:1 [ …1]
    "Project\View\Handler\ProjectHandler" => array:16 [ …16]
    "Project\View\Handler\ResultHandler" => array:8 [ …8]
    "Project\View\Handler\IdeaHandler" => array:11 [ …11]
    "Project\View\Helper\Project\StatusIcon" => array:1 [ …1]
    "Project\View\Helper\Project\ProjectDates" => array:3 [ …3]
    "Project\View\Helper\Description\BuildContent" => array:1 [ …1]
    "Project\View\Helper\Description\BuildNavigation" => array:2 [ …2]
    "Project\View\Helper\Description\BuildTree" => array:2 [ …2]
    "Project\View\Helper\Project\Quickstart" => array:2 [ …2]
    "Project\View\Helper\BuildHelp" => array:3 [ …3]
    "Project\View\Helper\Version\VersionLink" => array:6 [ …6]
    "Project\View\Helper\HelpLink" => array:6 [ …6]
    "Project\View\Helper\Report\ReportHelper" => array:1 [ …1]
    "Project\Form\View\Helper\ProjectFormElement" => array:2 [ …2]
    "Evaluation\Controller\ReportController" => array:4 [ …4]
    "Evaluation\Controller\FeedbackController" => array:4 [ …4]
    "Evaluation\Controller\EvaluationController" => array:10 [ …10]
    "Evaluation\Controller\EvaluationManagerController" => array:4 [ …4]
    "Evaluation\Controller\ReportManagerController" => array:5 [ …5]
    "Evaluation\Controller\Report\CriterionController" => array:4 [ …4]
    "Evaluation\Controller\Report\VersionController" => array:4 [ …4]
    "Evaluation\Controller\Report\WindowController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\CategoryController" => array:2 [ …2]
    "Evaluation\Controller\Report\Criterion\TypeController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\TopicController" => array:3 [ …3]
    "Evaluation\Controller\Report\Criterion\VersionController" => array:3 [ …3]
    "Evaluation\Controller\ReviewerManagerController" => array:5 [ …5]
    "Evaluation\Controller\ReviewScheduleController" => array:5 [ …5]
    "Evaluation\Controller\Reviewer\ContactManagerController" => array:2 [ …2]
    "Evaluation\Controller\JsonController" => array:3 [ …3]
    "Evaluation\Controller\Plugin\CreateEvaluation" => array:5 [ …5]
    "Evaluation\Controller\Plugin\RosterGenerator" => array:3 [ …3]
    "Evaluation\Controller\Plugin\Report\ExcelExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ExcelDownload" => array:2 [ …2]
    "Evaluation\Controller\Plugin\Report\ExcelImport" => array:1 [ …1]
    "Evaluation\Controller\Plugin\Report\PdfExport" => array:5 [ …5]
    "Evaluation\Controller\Plugin\Report\ConsolidatedPdfExport" => array:10 [ …10]
    "Evaluation\Controller\Plugin\Report\Presentation" => array:2 [ …2]
    "Evaluation\Controller\Plugin\RenderProjectEvaluation" => array:3 [ …3]
    "Evaluation\Service\EvaluationService" => array:1 [ …1]
    "Evaluation\Service\EvaluationReportService" => array:2 [ …2]
    "Evaluation\Service\ReviewerService" => array:1 [ …1]
    "Evaluation\Service\ReviewRosterService" => array:5 [ …5]
    "Evaluation\View\Helper\Report\Progress" => array:2 [ …2]
    "Evaluation\View\Helper\Report\Score" => array:1 [ …1]
    "Press\Controller\ArticleController" => array:5 [ …5]
    "Press\Controller\BureauController" => array:3 [ …3]
    "Press\Controller\PressController" => array:1 [ …1]
    "Press\Service\PressService" => array:2 [ …2]
    "Press\Search\Service\PressSearchService" => array:1 [ …1]
    "Press\View\Handler\PressHandler" => array:7 [ …7]
    "Program\Controller\Plugin\CreateCallFundingOverview" => array:5 [ …5]
    "Program\Controller\Plugin\CreateFundingDownload" => array:3 [ …3]
    "Program\Controller\Plugin\RenderDoa" => array:3 [ …3]
    "Program\Controller\Plugin\RenderNda" => array:3 [ …3]
    "Program\Controller\Plugin\CallSizeSpreadsheet" => array:8 [ …8]
    "Program\Controller\CallController" => array:6 [ …6]
    "Program\Controller\CallCountryManagerController" => array:4 [ …4]
    "Program\Controller\CallManagerController" => array:9 [ …9]
    "Program\Controller\DoaController" => array:4 [ …4]
    "Program\Controller\FunderManagerController" => array:3 [ …3]
    "Program\Controller\NdaController" => array:6 [ …6]
    "Program\Controller\NdaManagerController" => array:8 [ …8]
    "Program\Controller\ProgramManagerController" => array:3 [ …3]
    "Program\Service\ProgramService" => array:5 [ …5]
    "Program\Service\CallService" => array:3 [ …3]
    "Program\View\Handler\ProgramHandler" => array:6 [ …6]
    "Program\View\Helper\CallInformationBox" => array:3 [ …3]
    "Search\Controller\IndexController" => array:1 [ …1]
    "Search\Command\UpdateIndex" => array:1 [ …1]
    "Search\Service\ConsoleService" => array:22 [ …22]
    "Admin\Controller\AccessController" => array:5 [ …5]
    "Admin\Controller\AdminController" => array:9 [ …9]
    "Admin\Controller\QueueController" => array:2 [ …2]
    "Admin\Controller\Api\LogController" => array:1 [ …1]
    "Admin\Controller\UserController" => array:5 [ …5]
    "Admin\Controller\OAuth2Controller" => array:3 [ …3]
    "Admin\Controller\OAuth2\ClientController" => array:3 [ …3]
    "Admin\Controller\OAuth2\ScopeController" => array:2 [ …2]
    "Admin\Controller\StatisticsController" => array:3 [ …3]
    "Admin\Controller\CacheController" => array:1 [ …1]
    "Admin\Controller\FixController" => []
    "Admin\Controller\PermitController" => array:3 [ …3]
    "Admin\InputFilter\AccessFilter" => array:1 [ …1]
    "Admin\Service\AdminService" => array:3 [ …3]
    "Admin\Service\StatisticsService" => array:1 [ …1]
    "Admin\Service\QueueService" => array:1 [ …1]
    "Admin\Service\ApiService" => array:1 [ …1]
    "Admin\Service\OAuth2Service" => array:1 [ …1]
    "Admin\Form\View\Helper\AccessFormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FormCheckbox" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterBarElement" => array:2 [ …2]
    "LaminasBootstrap5\Form\View\Helper\FilterColumnElement" => array:2 [ …2]
    "Affiliation\Controller\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\EditController" => array:11 [ …11]
    "Affiliation\Controller\Admin\AffiliationController" => array:14 [ …14]
    "Affiliation\Controller\Admin\IndexController" => array:4 [ …4]
    "Affiliation\Controller\Admin\EditController" => array:11 [ …11]
    "Affiliation\Controller\Json\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Json\LoiController" => array:4 [ …4]
    "Affiliation\Controller\DoaController" => array:5 [ …5]
    "Affiliation\Controller\Doa\ManagerController" => array:9 [ …9]
    "Affiliation\Controller\LoiController" => array:5 [ …5]
    "Affiliation\Controller\Loi\ManagerController" => array:7 [ …7]
    "Affiliation\Controller\Questionnaire\CategoryManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireManagerController" => array:3 [ …3]
    "Affiliation\Controller\Questionnaire\QuestionnaireController" => array:4 [ …4]
    "Affiliation\Provider\AffiliationProvider" => array:2 [ …2]
    "Affiliation\Service\AffiliationService" => array:14 [ …14]
    "Affiliation\Service\QuestionnaireService" => array:2 [ …2]
    "Affiliation\Service\DoaService" => array:1 [ …1]
    "Affiliation\Service\LoiService" => array:1 [ …1]
    "Affiliation\Controller\Plugin\RenderPaymentSheet" => array:9 [ …9]
    "Affiliation\Controller\Plugin\RenderLoi" => array:3 [ …3]
    "Affiliation\Controller\Plugin\MergeAffiliation" => array:2 [ …2]
    "Affiliation\View\Helper\PaymentSheet" => array:8 [ …8]
    "Affiliation\View\Helper\Questionnaire\QuestionnaireHelper" => array:1 [ …1]
    "Organisation\Controller\JsonController" => array:3 [ …3]
    "Organisation\Controller\Organisation\NoteController" => array:3 [ …3]
    "Organisation\Controller\ImageController" => array:3 [ …3]
    "Organisation\Controller\BoardController" => array:3 [ …3]
    "Organisation\Controller\Organisation\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Organisation\FinancialController" => array:4 [ …4]
    "Organisation\Controller\Organisation\ListController" => array:2 [ …2]
    "Organisation\Controller\Organisation\ManagerController" => array:7 [ …7]
    "Organisation\Controller\Organisation\TypeController" => array:3 [ …3]
    "Organisation\Controller\AdvisoryBoard\City\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\City\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\AdvisoryBoard\Solution\ManagerController" => array:5 [ …5]
    "Organisation\Controller\AdvisoryBoard\Solution\Manager\DetailsController" => array:1 [ …1]
    "Organisation\Controller\SelectionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ContributionController" => array:3 [ …3]
    "Organisation\Controller\Parent\ManagerController" => array:5 [ …5]
    "Organisation\Controller\Parent\ListController" => array:5 [ …5]
    "Organisation\Controller\Parent\DetailsController" => array:7 [ …7]
    "Organisation\Controller\Parent\OrganisationController" => array:6 [ …6]
    "Organisation\Controller\Parent\TypeController" => array:3 [ …3]
    "Organisation\Controller\Parent\DoaController" => array:6 [ …6]
    "Organisation\Controller\Parent\FinancialController" => array:6 [ …6]
    "Organisation\Controller\UpdateController" => array:4 [ …4]
    "Organisation\Controller\Update\ManagerController" => array:5 [ …5]
    "Organisation\Command\Cleanup" => array:1 [ …1]
    "Organisation\Search\Service\OrganisationSearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\CitySearchService" => array:1 [ …1]
    "Organisation\Search\Service\AdvisoryBoard\SolutionSearchService" => array:1 [ …1]
    "Organisation\View\Handler\OrganisationHandler" => array:9 [ …9]
    "Organisation\View\Handler\AdvisoryBoard\CityHandler" => array:7 [ …7]
    "Organisation\View\Handler\AdvisoryBoard\SolutionHandler" => array:7 [ …7]
    "Organisation\Controller\Plugin\HandleParentAndProjectImport" => array:8 [ …8]
    "Organisation\Controller\Plugin\RenderOverviewExtraVariableContributionSheet" => array:7 [ …7]
    "Organisation\Controller\Plugin\RenderOverviewVariableContributionSheet" => array:8 [ …8]
    "Organisation\Controller\Plugin\Merge\OrganisationMerge" => array:4 [ …4]
    "Organisation\Controller\Plugin\Merge\ParentOrganisationMerge" => array:2 [ …2]
    "Organisation\Controller\Plugin\SelectionExport" => array:2 [ …2]
    "Organisation\Form\OrganisationForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\CityForm" => array:1 [ …1]
    "Organisation\Form\AdvisoryBoard\SolutionForm" => array:1 [ …1]
    "Organisation\Form\UpdateForm" => array:1 [ …1]
    "Organisation\Form\FinancialForm" => array:1 [ …1]
    "Organisation\Form\View\Helper\OrganisationFormElement" => array:3 [ …3]
    "Organisation\Form\View\Helper\ParentFormElement" => array:2 [ …2]
    "Organisation\View\Helper\UpdateNotification" => array:2 [ …2]
    "Organisation\View\Helper\Parent\Contribution\OverviewVariableContribution" => array:7 [ …7]
    "Organisation\View\Helper\Parent\Contribution\OverviewExtraVariableContribution" => array:7 [ …7]
    "Organisation\Service\AdvisoryBoard\CityService" => array:3 [ …3]
    "Organisation\Service\AdvisoryBoard\SolutionService" => array:3 [ …3]
    "Organisation\Service\BoardService" => array:1 [ …1]
    "Organisation\Service\SelectionService" => array:1 [ …1]
    "Organisation\Service\UpdateService" => array:3 [ …3]
    "Publication\Acl\Assertion\Publication" => array:4 [ …4]
    "Publication\Controller\CategoryController" => array:3 [ …3]
    "Publication\Controller\CommunityController" => array:1 [ …1]
    "Publication\Controller\PublicationController" => array:1 [ …1]
    "Publication\Controller\PublicationManagerController" => array:5 [ …5]
    "Publication\Controller\TypeController" => array:4 [ …4]
    "Publication\Search\Service\PublicationSearchService" => array:1 [ …1]
    "Publication\Service\PublicationService" => array:3 [ …3]
    "Invoice\Controller\ConsoleController" => array:1 [ …1]
    "Invoice\Controller\DimensionController" => array:3 [ …3]
    "Invoice\Controller\ExportController" => array:2 [ …2]
    "Invoice\Controller\ForecastController" => array:3 [ …3]
    "Invoice\Controller\InvoiceController" => array:17 [ …17]
    "Invoice\Controller\InvoiceCreateController" => array:15 [ …15]
    "Invoice\Controller\JournalController" => array:1 [ …1]
    "Invoice\Controller\PdfController" => array:1 [ …1]
    "Invoice\Controller\ReminderController" => array:7 [ …7]
    "Invoice\Controller\RowController" => array:4 [ …4]
    "Invoice\Controller\TransactionController" => array:2 [ …2]
    "Invoice\Controller\WordController" => array:1 [ …1]
    "Invoice\Command\DailyUpdate" => array:4 [ …4]
    "Invoice\Command\Sync" => array:1 [ …1]
    "Invoice\Controller\Plugin\CreateCreditInvoice" => array:2 [ …2]
    "Invoice\Controller\Plugin\CreateIncomeForecast" => array:6 [ …6]
    "Invoice\Controller\Plugin\InvoiceExport" => array:3 [ …3]
    "Invoice\Controller\Plugin\InvoiceExportUbl" => array:4 [ …4]
    "Invoice\Controller\Plugin\RenderInvoice" => array:8 [ …8]
    "Invoice\Controller\Plugin\RenderReminder" => array:5 [ …5]
    "Invoice\Controller\Plugin\CreateInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentInvoice" => array:4 [ …4]
    "Invoice\Controller\Plugin\CreateWordInvoice" => array:7 [ …7]
    "Invoice\Controller\Plugin\CreateParentExtraInvoice" => array:4 [ …4]
    "Invoice\Service\InvoiceService" => array:9 [ …9]
    "Invoice\Service\TransactionService" => array:3 [ …3]
    "Invoice\Search\Service\InvoiceSearchService" => array:1 [ …1]
    "Invoice\View\Helper\DailyUpdateHandler" => array:2 [ …2]
    "Deeplink\Controller\DeeplinkController" => array:5 [ …5]
    "Deeplink\Controller\TargetController" => array:4 [ …4]
    "Deeplink\InputFilter\TargetFilter" => array:2 [ …2]
    "Deeplink\Service\DeeplinkService" => array:2 [ …2]
    "Deeplink\View\Helper\CanAssemble" => array:1 [ …1]
    "Event\Controller\BadgeImageManagerController" => array:9 [ …9]
    "Event\Controller\BadgeManagerController" => array:13 [ …13]
    "Event\Controller\BoothController" => array:10 [ …10]
    "Event\Controller\BoothManagerController" => array:9 [ …9]
    "Event\Controller\BoothSpecManagerController" => array:4 [ …4]
    "Event\Controller\DeskCostsController" => array:2 [ …2]
    "Event\Controller\ExhibitionCostController" => array:3 [ …3]
    "Event\Controller\ExhibitionSpecManagerController" => array:3 [ …3]
    "Event\Controller\ExhibitionManagerController" => array:5 [ …5]
    "Event\Controller\ExportController" => array:1 [ …1]
    "Event\Controller\JsonController" => array:4 [ …4]
    "Event\Controller\Meeting\AdminController" => array:4 [ …4]
    "Event\Controller\Meeting\MeetingController" => array:9 [ …9]
    "Event\Controller\Meeting\CostController" => array:2 [ …2]
    "Event\Controller\Meeting\QuotaController" => array:4 [ …4]
    "Event\Controller\Meeting\CouponController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionController" => array:2 [ …2]
    "Event\Controller\Meeting\OptionCostController" => array:2 [ …2]
    "Event\Controller\Meeting\FloorplanController" => array:5 [ …5]
    "Event\Controller\Meeting\ManagerController" => array:14 [ …14]
    "Event\Controller\RegistrationController" => array:9 [ …9]
    "Event\Controller\PaymentController" => array:3 [ …3]
    "Event\Controller\RegistrationManagerController" => array:7 [ …7]
    "Event\Controller\TicketManagerController" => array:11 [ …11]
    "Event\Job\CometChat\CreateUser" => array:3 [ …3]
    "Event\Job\CometChat\CreateAuthToken" => array:3 [ …3]
    "Event\Job\CometChat\DeleteUser" => array:3 [ …3]
    "Event\Command\CancelPaymentPending" => array:1 [ …1]
    "Event\Command\UpdateRegistrations" => array:1 [ …1]
    "Event\Controller\Plugin\BoothExport" => array:3 [ …3]
    "Event\Controller\Plugin\RegistrationExport" => array:1 [ …1]
    "Event\Controller\Plugin\RenderReceipt" => array:4 [ …4]
    "Event\Controller\Plugin\MeetingFacebook" => array:4 [ …4]
    "Event\Controller\Plugin\BadgePdf" => array:5 [ …5]
    "Event\Controller\Plugin\TicketPdf" => array:4 [ …4]
    "Event\View\Handler\MeetingHandler" => array:8 [ …8]
    "Event\View\Helper\RegistrationLink" => array:6 [ …6]
    "Event\Search\Service\RegistrationSearchService" => array:1 [ …1]
    "Event\Service\BadgeService" => array:1 [ …1]
    "Event\Service\MeetingService" => array:4 [ …4]
    "Event\Service\ExhibitionService" => array:1 [ …1]
    "Event\Service\BoothService" => array:3 [ …3]
    "Event\Service\RegistrationService" => array:16 [ …16]
    "Event\Service\ExhibitionFloorplanService" => array:1 [ …1]
    "Event\Service\ExhibitionSpecService" => array:1 [ …1]
    "Calendar\Controller\CalendarController" => array:2 [ …2]
    "Calendar\Controller\TypeController" => array:2 [ …2]
    "Calendar\Controller\CommunityController" => array:11 [ …11]
    "Calendar\Controller\DocumentController" => array:4 [ …4]
    "Calendar\Controller\JsonController" => array:1 [ …1]
    "Calendar\Controller\ManagerController" => array:10 [ …10]
    "Calendar\Controller\Plugin\RenderCalendarContactList" => array:3 [ …3]
    "Calendar\Controller\Plugin\RenderReviewCalendar" => array:2 [ …2]
    "Calendar\Service\CalendarService" => array:7 [ …7]
    "Calendar\Search\Service\CalendarSearchService" => array:1 [ …1]
    "Calendar\View\Handler\CalendarHandler" => array:7 [ …7]
    "Mailing\Command\FlushQueue" => array:1 [ …1]
    "Mailing\Command\SendQueue" => array:1 [ …1]
    "Mailing\Controller\AttachmentController" => array:2 [ …2]
    "Mailing\Controller\ConsoleController" => array:1 [ …1]
    "Mailing\Controller\MailingContactController" => array:1 [ …1]
    "Mailing\Controller\MailingManagerController" => array:6 [ …6]
    "Mailing\Controller\JsonController" => array:3 [ …3]
    "Mailing\Controller\MailingSubscriptionController" => array:6 [ …6]
    "Mailing\Controller\SenderManagerController" => array:3 [ …3]
    "Mailing\Controller\TemplateManagerController" => array:3 [ …3]
    "Mailing\InputFilter\MailingFilter" => array:1 [ …1]
    "Mailing\InputFilter\SenderFilter" => array:1 [ …1]
    "Mailing\InputFilter\TemplateFilter" => array:1 [ …1]
    "Mailing\Service\MailingService" => array:4 [ …4]
    "Accounting\Controller\TwinfieldController" => array:2 [ …2]
    "Accounting\Adapter\TwinfieldAdapter" => array:3 [ …3]
  ]
  "lmc_cors" => array:3 [
    "allowed_origins" => array:1 [ …1]
    "allowed_methods" => array:5 [ …5]
    "allowed_headers" => array:3 [ …3]
  ]
  "console" => array:1 [
    "router" => array:1 [ …1]
  ]
  "zfctwig" => array:9 [
    "environment_loader" => "ZfcTwigLoaderChain"
    "environment_class" => "Twig\Environment"
    "environment_options" => array:2 [ …2]
    "loader_chain" => array:3 [ …3]
    "extensions" => array:14 [ …14]
    "suffix" => "twig"
    "enable_fallback_functions" => true
    "disable_zf_model" => false
    "helper_manager" => array:1 [ …1]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [ …6]
    "toolbar" => array:5 [ …5]
    "events" => array:3 [ …3]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:7 [ …7]
    "factories" => array:7 [ …7]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [ …1]
  ]
  "translator" => array:3 [
    "locale" => "en_GB"
    "cache" => true
    "translation_file_patterns" => array:1 [ …1]
  ]
  "web" => array:5 [
    "title" => "ITEA 4"
    "description" => "ITEA is the Eureka R&D&I Cluster programme for software innovation, enabling a large international community to collaborate in funded projects that turn innovative ideas into new businesses, jobs, economic growth and benefits for society."
    "keywords" => "Software-intensive Systems & Services, EUREKA Cluster, R&D, R&D projects, Innovation, Business Impact, Seizing the high ground, Fast Exploitation, Happiness"
    "author" => "Johan van der Heide, johan.van.der.heide[at]itea4.org"
    "site_name" => "itea4.org"
  ]
  "authenticate" => array:1 [
    "useAdditionalEmailAddresses" => true
  ]
  "session_config" => array:3 [
    "cache_expire" => 86400
    "cookie_lifetime" => 86400
    "name" => "itea"
  ]
  "navigation" => array:6 [
    "default" => []
    "project-community" => []
    "community" => array:6 [ …6]
    "admin" => array:14 [ …14]
    "community2" => array:1 [ …1]
    "call" => array:6 [ …6]
  ]
  "content_option" => array:3 [
    "vimeoClientId" => "08fdab5ca150505195e18a91774f67a6bae59cd3"
    "vimeoClientSecret" => "5Dc8mhmhiByGpBp7XFoY7+6rTi5NXGu+OWuU4E97JELWz3oNryFAP0GsbC/h9tvY4KA3dTORoQ31dIk5AGx1HRwjR5t2uXTpZEHMSkWdnjqKi3GFs7acWyzg6mIGEfdV"
    "vimeoAccessToken" => "947086738c8843c59ea7755d410c2288"
  ]
  "general_option" => array:5 [
    "serverUrl" => "https://dev1.itea4.org"
    "thumborServer" => "https://image.itea3.org"
    "thumborSecret" => "mKiWlumnpbX1YWpW6lbm"
    "assets" => "/var/www/dev1/config/itea/../../styles/itea/img"
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "cluster_options" => array:2 [
    "reporting_portal_api_url" => "https://api.eurekaclusters.eu"
    "bearer_token" => "abcd"
  ]
  "slm_queue" => array:6 [
    "job_manager" => array:1 [ …1]
    "queues" => array:1 [ …1]
    "worker_strategies" => array:2 [ …2]
    "strategy_manager" => array:2 [ …2]
    "queue_manager" => array:1 [ …1]
    "worker_manager" => []
  ]
  "project_option" => array:9 [
    "rationale_require_contact_with_funder" => false
    "evaluation_project_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "evaluation_report_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "evaluation_presentation_templates" => array:2 [ …2]
    "evaluation_report_author" => "Itea Office"
    "project_summary_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/project-summary.docx"
    "change_request_document_template" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/cr-document.docx"
    "header_logo" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/project/config/../../../styles/itea/template/word/footer.png"
  ]
  "evaluation_options" => array:4 [
    "projectTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "reportTemplate" => "/var/www/dev1/module/evaluation/config/../../../styles/itea/template/pdf/evaluation-report-template.pdf"
    "presentationTemplates" => array:2 [ …2]
    "reportAuthor" => "ITEA Office"
  ]
  "program_option" => array:6 [
    "nda_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "doa_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "blank_template" => "/var/www/dev1/module/program/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "has_nda" => true
    "header_logo" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/logo.png"
    "footer_image" => "/var/www/dev1/module/program/config/../../../styles/itea/template/word/footer.png"
  ]
  "google" => array:1 [
    "cx" => "009339216969913709813:g_lfsuqxjz0"
  ]
  "solr" => array:2 [
    "host" => "app2"
    "connection" => array:23 [ …23]
  ]
  "admin_option" => array:1 [
    "community_navigation_container" => "Laminas\Navigation\Community2"
  ]
  "affiliation_option" => array:3 [
    "doa_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/doa-template.pdf"
    "loi_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/nda-template.pdf"
    "payment_sheet_template" => "/var/www/dev1/module/affiliation/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "organisation_option" => array:2 [
    "overview_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
    "overview_extra_variable_contribution_template" => "/var/www/dev1/module/organisation/config/../../../styles/itea/template/pdf/aeneas-template.pdf"
  ]
  "invoice_option" => array:11 [
    "mollie_api_key" => "live_lsaXAz3GAweHE1zzTr15WPt5FEZFeB"
    "payment_days" => 30
    "complaint_days" => 14
    "contract_data_start_year" => 2018
    "invoice_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/pdf/invoice-template.pdf"
    "variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/variable-fee-template.docx"
    "extra_variable_fee_word_template" => "/var/www/dev1/module/invoice/config/../../../styles/itea/template/word/extra-variable-fee-template.docx"
    "invoice_mask" => "YYYY####"
    "local_country" => "NLD"
    "bcc_email_address" => "finance@itea4.org"
    "from_email_address" => "finance@itea4.org"
  ]
  "event_option" => array:1 [
    "receipt_template" => "/var/www/dev1/module/event/config/../../../styles/itea/template/pdf/invoice-template.pdf"
  ]
  "calendar_option" => array:2 [
    "calendar_contact_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/blank-template.pdf"
    "review_calendar_template" => "/var/www/dev1/module/calendar/config/../../../styles/itea/template/pdf/review-calendar-template.pdf"
  ]
  "google_analytics" => array:7 [
    "enable" => true
    "id" => ""
    "domain_name" => ""
    "allow_linker" => false
    "enable_display_advertising" => false
    "anonymize_ip" => false
    "script" => "google-analytics-ga"
  ]
  "accounting_options" => array:5 [
    "clientId" => ""
    "clientSecret" => ""
    "refreshToken" => ""
    "redirectURL" => ""
    "office" => ""
  ]
  "listeners" => array:1 [
    0 => "ErrorHeroModule\Listener\Mvc"
  ]
  "email" => array:3 [
    "general" => array:2 [ …2]
    "smtp" => array:5 [ …5]
    "mailjet" => array:2 [ …2]
  ]
  "log" => array:1 [
    "ErrorHeroModuleLogger" => array:1 [ …1]
  ]
  "error-hero-module" => array:5 [
    "enable" => true
    "enable-error-preview-page" => true
    "display-settings" => array:6 [ …6]
    "logging-settings" => array:1 [ …1]
    "email-notification-settings" => array:5 [ …5]
  ]
  "jield_authorize" => array:6 [
    "default_role" => "public"
    "authenticated_role" => "user"
    "access_service" => "Admin\Service\AdminService"
    "permit_service" => "Contact\Service\ContactService"
    "cache_enabled" => true
    "role_entity_class" => "Admin\Entity\Access"
  ]
  "circlical" => array:1 [
    "recaptcha" => array:3 [ …3]
  ]
  "accounting" => array:2 [
    "adapter" => "Accounting\Adapter\Twinfield"
    "options" => array:7 [ …7]
  ]
  "cache" => array:1 [
    "adapter" => array:2 [ …2]
  ]
  "cometchat" => array:5 [
    "app_id" => "190005357f8fde86"
    "region" => "eu"
    "version" => 2
    "auth_key" => "f333a70ecae8f9362a869d8a5753dea3156109c8"
    "api_key" => "344ac4fb44725064a40306c597afac4ba3430f81"
  ]
  "zfr_cors" => array:1 [
    "allowed_origins" => array:3 [ …3]
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
^ array:3 [
  "modules" => array:63 [
    0 => "Laminas\Cache"
    1 => "Laminas\Router"
    2 => "Laminas\Form"
    3 => "Laminas\Navigation"
    4 => "Laminas\Filter"
    5 => "Laminas\Hydrator"
    6 => "Laminas\InputFilter"
    7 => "Laminas\Paginator"
    8 => "Laminas\Router"
    9 => "Laminas\Log"
    10 => "Laminas\Validator"
    11 => "Laminas\Mvc\Plugin\FlashMessenger"
    12 => "Laminas\Mvc\Plugin\Identity"
    13 => "Laminas\ApiTools"
    14 => "Laminas\ApiTools\Documentation"
    15 => "Laminas\ApiTools\Documentation\Swagger"
    16 => "Laminas\ApiTools\ApiProblem"
    17 => "Laminas\ApiTools\Configuration"
    18 => "Laminas\ApiTools\OAuth2"
    19 => "Laminas\ApiTools\MvcAuth"
    20 => "Laminas\ApiTools\Hal"
    21 => "Laminas\ApiTools\ContentNegotiation"
    22 => "Laminas\ApiTools\ContentValidation"
    23 => "Laminas\ApiTools\Rest"
    24 => "Laminas\ApiTools\Rpc"
    25 => "Laminas\ApiTools\Versioning"
    26 => "Api"
    27 => "LmcCors"
    28 => "AssetManager"
    29 => "ZfcTwig"
    30 => "BjyAuthorize"
    31 => "Jield\Authorize"
    32 => "DoctrineModule"
    33 => "DoctrineORMModule"
    34 => "Application"
    35 => "Content"
    36 => "General"
    37 => "Cluster"
    38 => "News"
    39 => "Contact"
    40 => "Quality"
    41 => "Project"
    42 => "Evaluation"
    43 => "Press"
    44 => "Program"
    45 => "Search"
    46 => "Admin"
    47 => "LaminasBootstrap5"
    48 => "Affiliation"
    49 => "Organisation"
    50 => "Publication"
    51 => "Invoice"
    52 => "Deeplink"
    53 => "Event"
    54 => "Calendar"
    55 => "Mailing"
    56 => "LaminasGoogleAnalytics"
    57 => "Accounting"
    58 => "ErrorHeroModule"
    59 => "CirclicalRecaptcha"
    60 => "SlmQueue"
    61 => "SlmQueueDoctrine"
    62 => "Laminas\DeveloperTools"
  ]
  "module_listener_options" => array:7 [
    "config_glob_paths" => array:2 [
      0 => "config/autoload/{,*.}{global,local}.php"
      1 => "config/itea/{,*.}{global,local}.php"
    ]
    "config_cache_enabled" => false
    "cache_dir" => "/var/www/dev1/config/../data/cache"
    "config_cache_key" => "itea"
    "module_map_cache_enabled" => true
    "module_map_cache_key" => "50b41c6263a4a7e8e9298092a44a713d"
    "module_paths" => array:2 [
      0 => "./module"
      1 => "./vendor"
    ]
  ]
  "service_manager" => array:2 [
    "use_defaults" => true
    "factories" => []
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
BjyAuthorize Current Identity Roles public
BjyAuthorize
Identity Roles - 1 role

public
Doctrine ORM (Queries) 188 queries in 143.54 ms
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.session_id AS session_id_1, t0.session_key AS session_key_2, t0.session_name AS session_name_3, t0.ip AS ip_4, t0.date_start AS date_start_5, t0.date_end AS date_end_6, t0.modified AS modified_7, t0.lifetime AS lifetime_8, t0.hits AS hits_9, t0.data AS data_10, t0.contact_id AS contact_id_11 FROM session t0 WHERE t0.session_key = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '260qns583be997qhfoc6ug054n' (length=26)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0018060207366943
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00092792510986328
SQL SELECT t0.topic_id AS topic_id_1, t0.topic AS topic_2, t0.docref AS docref_3, t0.route_id AS route_id_4, t0.meeting_id AS meeting_id_5, t0.template_id AS template_id_6 FROM article_topic t0 WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078082084655762
SQL SELECT t0.node_id AS node_id_1, t0.title AS title_2, t0.start_date AS start_date_3, t0.end_date AS end_date_4, t0.uri AS uri_5, t0.activated AS activated_6, t0.hide_from_navigation AS hide_from_navigation_7, t8.main_id AS main_id_9, t8.sequence AS sequence_10, t8.node_id AS node_id_11, t12.tree_id AS tree_id_13, t12.sequence AS sequence_14, t12.parentid AS parentid_15, t12.child_node_id AS child_node_id_16, t12.parent_node_id AS parent_node_id_17, t0.template_id AS template_id_18, t0.layout_template_id AS layout_template_id_19, t0.route_id AS route_id_20 FROM node t0 LEFT JOIN node_main t8 ON t8.node_id = t0.node_id LEFT JOIN node_tree t12 ON t12.child_node_id = t0.node_id WHERE t0.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0015721321105957
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'success-stories' (length=15)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00094318389892578
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN node_access_link ON t0.access_id = node_access_link.access_id WHERE node_access_link.node_id = ? ORDER BY t0.access ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1431
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0016210079193115
SQL SELECT t0.content_id AS content_id_1, t0.sequence AS sequence_2, t0.handler_id AS handler_id_3, t0.segment_id AS segment_id_4, t0.node_id AS node_id_5 FROM content t0 WHERE t0.node_id = ? ORDER BY t0.sequence ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1431
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010058879852295
SQL SELECT t0.handler_id AS handler_id_1, t0.handler AS handler_2 FROM content_handler t0 WHERE t0.handler_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 79
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065016746520996
SQL SELECT c0_.route_id AS route_id_0, c0_.route AS route_1, c0_.`assertion` AS assertion_2 FROM content_route c0_ WHERE c0_.route_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '1' (length=1)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00057792663574219
SQL SELECT n0_.node_id AS node_id_0, n0_.title AS title_1, n0_.start_date AS start_date_2, n0_.end_date AS end_date_3, n0_.uri AS uri_4, n0_.activated AS activated_5, n0_.hide_from_navigation AS hide_from_navigation_6, n0_.template_id AS template_id_7, n0_.layout_template_id AS layout_template_id_8, n0_.route_id AS route_id_9 FROM node n0_ WHERE n0_.uri = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'success-stories' (length=15)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.00062680244445801
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 118
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0011060237884521
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00069999694824219
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00052189826965332
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00051999092102051
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0005950927734375
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00052404403686523
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00047183036804199
SQL SELECT t0.template_id AS template_id_1, t0.template AS template_2, t0.content AS content_3, t0.type AS type_4, t0.date_created AS date_created_5, t0.last_update AS last_update_6 FROM content_template t0 WHERE t0.template = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'page-no-container with ITEA 4 header image old-green golden ratio' (length=65)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060892105102539
SQL SELECT t0.segment_id AS segment_id_1, t0.segment AS segment_2 FROM content_segment t0 WHERE t0.segment_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064396858215332
SQL SELECT t0.content_param_id AS content_param_id_1, t0.param AS param_2, t0.content_id AS content_id_3, t0.param_id AS param_id_4 FROM content_param t0 WHERE t0.content_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 949
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060105323791504
SQL SELECT t0.param_id AS param_id_1, t0.param AS param_2 FROM content_handler_param t0 WHERE t0.param_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 29
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00073504447937012
SQL SELECT t0.result_id AS result_id_1, t0.result AS result_2, t0.docref AS docref_3, t0.date_created AS date_created_4, t0.date_released AS date_released_5, t0.abstract AS abstract_6, t0.html AS html_7, t0.css AS css_8, t0.size AS size_9, t0.date_updated AS date_updated_10, t0.contenttype_id AS contenttype_id_11, t0.contact_id AS contact_id_12, t0.project_id AS project_id_13, t0.type_id AS type_id_14, t0.image_id AS image_id_15 FROM result t0 WHERE t0.docref = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'success-stories' (length=15)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0011789798736572
SQL SELECT t0.type_id AS type_id_1, t0.type AS type_2, t0.title AS title_3, t0.description AS description_4, t0.`sequence` AS sequence_5, t0.list_type AS list_type_6, t0.category_id AS category_id_7 FROM result_type t0 WHERE t0.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00074291229248047
SQL SELECT COUNT(*) AS dctrn_count FROM (SELECT DISTINCT result_id_0 FROM (SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9 FROM result r0_ WHERE r0_.type_id = ? AND r0_.html <> ? ORDER BY r0_.date_released DESC) dctrn_result) dctrn_table Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '' (length=0)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.0016748905181885
SQL SELECT DISTINCT result_id_0 FROM (SELECT DISTINCT result_id_0, date_released_4 FROM (SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9 FROM result r0_ WHERE r0_.type_id = ? AND r0_.html <> ?) dctrn_result_inner ORDER BY date_released_4 DESC) dctrn_result LIMIT 25 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '' (length=0)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
Time 0.0011191368103027
SQL SELECT r0_.result_id AS result_id_0, r0_.result AS result_1, r0_.docref AS docref_2, r0_.date_created AS date_created_3, r0_.date_released AS date_released_4, r0_.abstract AS abstract_5, r0_.html AS html_6, r0_.css AS css_7, r0_.size AS size_8, r0_.date_updated AS date_updated_9, r0_.contenttype_id AS contenttype_id_10, r0_.contact_id AS contact_id_11, r0_.project_id AS project_id_12, r0_.type_id AS type_id_13, r0_.image_id AS image_id_14 FROM result r0_ WHERE r0_.type_id = ? AND r0_.html <> ? AND r0_.result_id IN (?) ORDER BY r0_.date_released DESC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string '' (length=0)
    2 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74: array (size=25) 0 => int 7427 1 => int 7429 2 => int 7374 3 => int 7377 4 => int 7354 5 => int 7355 6 => int 7333 7 => int 7336 8 => int 7279 9 => int 7282 10 => int 7259 11 => int 7257 12 => int 7223 13 => int 7217 14 => int 7219 15 => int 7189 16 => int 7192 17 => int 7170 18 => int 7150 19 => int 7097 20 => int 7038 21 => int 7002 22 => int 7005 23 => int 6992 24 => int 6994
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
    1 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2
    2 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 101
Time 0.00484299659729
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010490417480469
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4447
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00093889236450195
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00085186958312988
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10218
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00094199180603027
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7427
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.001554012298584
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7427
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0017120838165283
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 INNER JOIN result_type_access ON t0.access_id = result_type_access.access_id WHERE result_type_access.type_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 23
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0009310245513916
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00072097778320312
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060296058654785
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4334
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006718635559082
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10246
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00078511238098145
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7429
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0009300708770752
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7429
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010280609130859
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00056600570678711
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057291984558105
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8591
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.000640869140625
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10211
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064587593078613
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7374
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071310997009277
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7374
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00091409683227539
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054001808166504
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053215026855469
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 2532
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060296058654785
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10249
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006108283996582
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7377
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006558895111084
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7377
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00087594985961914
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054478645324707
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050711631774902
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8011
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00059199333190918
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10170
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064492225646973
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7354
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00070881843566895
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7354
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00085997581481934
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00060319900512695
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050711631774902
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8014
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060296058654785
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10206
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064992904663086
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7355
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071501731872559
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7355
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00086498260498047
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00051999092102051
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053000450134277
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 6841
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00061202049255371
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10166
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006401538848877
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7333
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00072598457336426
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7333
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00098896026611328
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054597854614258
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053191184997559
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4368
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062990188598633
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10226
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00071501731872559
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7336
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010418891906738
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7336
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.001068115234375
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00082206726074219
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057315826416016
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1621
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063204765319824
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10114
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063514709472656
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7279
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00093221664428711
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7279
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010361671447754
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054407119750977
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050806999206543
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4913
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00065183639526367
SQL SELECT t0.contenttype_id AS contenttype_id_1, t0.description AS description_2, t0.contenttype AS contenttype_3, t0.extension AS extension_4, t0.gifimage AS gifimage_5 FROM contenttype t0 WHERE t0.contenttype_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 8
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054693222045898
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1136
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060510635375977
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7282
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00083589553833008
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7282
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00093197822570801
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00055789947509766
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050616264343262
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5758
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0005488395690918
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10178
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006718635559082
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7259
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00083303451538086
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7259
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00111985206604
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00056695938110352
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0005791187286377
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5775
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063109397888184
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 227
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00068902969360352
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7257
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082302093505859
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7257
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00096297264099121
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00053691864013672
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00049805641174316
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5354
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00052213668823242
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10212
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063204765319824
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7223
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00086307525634766
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7223
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00091695785522461
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00050806999206543
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00048303604125977
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4520
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054383277893066
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10137
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006558895111084
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7217
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010318756103516
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7217
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010190010070801
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054502487182617
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00051712989807129
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 5344
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00060892105102539
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 1127
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00063300132751465
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7219
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0008080005645752
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7219
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00095605850219727
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057005882263184
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00049710273742676
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4307
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0007319450378418
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10013
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00064611434936523
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7189
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082993507385254
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7189
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0008690357208252
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00054788589477539
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.0004889965057373
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 4298
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00054216384887695
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10106
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00068211555480957
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7192
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00087618827819824
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7192
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00097513198852539
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00057601928710938
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00051498413085938
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 3906
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00080084800720215
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10163
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00077104568481445
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7170
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00098514556884766
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7170
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0010089874267578
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00055980682373047
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00055599212646484
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 3612
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0006561279296875
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10162
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00069308280944824
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 INNER JOIN result_project ON t0.project_id = result_project.project_id WHERE result_project.result_id = ? ORDER BY t0.project ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7150
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00082302093505859
SQL SELECT t0.organisation_id AS organisation_id_1, t0.organisation AS organisation_2, t0.date_created AS date_created_3, t0.docref AS docref_4, t0.date_updated AS date_updated_5, t6.parent_id AS parent_id_7, t6.member_type AS member_type_8, t6.eposs_member_type AS eposs_member_type_9, t6.artemisia_member_type AS artemisia_member_type_10, t6.date_created AS date_created_11, t6.date_parent_type_update AS date_parent_type_update_12, t6.date_updated AS date_updated_13, t6.date_end AS date_end_14, t6.contact_id AS contact_id_15, t6.type_id AS type_id_16, t6.organisation_id AS organisation_id_17, t18.parent_organisation_id AS parent_organisation_id_19, t18.parent_id AS parent_id_20, t18.contact_id AS contact_id_21, t18.organisation_id AS organisation_id_22, t0.country_id AS country_id_23, t0.type_id AS type_id_24, t25.description_id AS description_id_26, t25.description AS description_27, t25.organisation_id AS organisation_id_28, t29.financial_id AS financial_id_30, t29.vat AS vat_31, t29.date_vat AS date_vat_32, t29.vat_status AS vat_status_33, t29.omitcontact AS omitcontact_34, t29.iban AS iban_35, t29.supplier_number AS supplier_number_36, t29.bic AS bic_37, t29.required_purchase_order AS required_purchase_order_38, t29.send_only_invoice AS send_only_invoice_39, t29.email AS email_40, t29.organisation_id AS organisation_id_41 FROM organisation t0 LEFT JOIN organisation_parent t6 ON t6.organisation_id = t0.organisation_id LEFT JOIN organisation_parent_organisation t18 ON t18.organisation_id = t0.organisation_id LEFT JOIN organisation_description t25 ON t25.organisation_id = t0.organisation_id LEFT JOIN organisation_financial t29 ON t29.organisation_id = t0.organisation_id INNER JOIN result_organisation ON t0.organisation_id = result_organisation.organisation_id WHERE result_organisation.result_id = ? ORDER BY t0.organisation ASC Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 7150
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.0009160041809082
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00055718421936035
SQL SELECT t0.access_id AS access_id_1, t0.access AS access_2, t0.description AS description_3 FROM access t0 WHERE t0.access = ? LIMIT 1 Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'office' (length=6)
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'string' (length=6)
Time 0.00049996376037598
SQL SELECT t0.image_id AS image_id_1, t0.image AS image_2, t0.date_created AS date_created_3, t0.size AS size_4, t0.width AS width_5, t0.height AS height_6, t0.date_updated AS date_updated_7, t0.contenttype_id AS contenttype_id_8 FROM image t0 WHERE t0.image_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 3117
Types     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:string 'integer' (length=7)
Time 0.00062680244445801
SQL SELECT t0.project_id AS project_id_1, t0.project_nr AS project_nr_2, t0.project AS project_3, t0.docref AS docref_4, t0.title AS title_5, t0.date_start AS date_start_6, t0.date_pca_signed AS date_pca_signed_7, t0.date_end AS date_end_8, t0.date_start_actual AS date_start_actual_9, t0.date_end_actual AS date_end_actual_10, t0.date_start_expected AS date_start_expected_11, t0.date_created AS date_created_12, t0.description AS description_13, t0.summary AS summary_14, t0.html AS html_15, t0.programcall_id AS programcall_id_16, t0.contact_id AS contact_id_17 FROM project t0 WHERE t0.project_id = ? Params     0 => /var/www/dev1/vendor/doctrine/common/lib/Doctrine/Common/Util/Debug.php:74:int 10156
Types